Viewing data for Tursiops truncatus


Scientific name Tursiops truncatus
Common name Bottlenosed dolphin
Maximum lifespan 51.60 years (Tursiops truncatus@AnAge)

Total mtDNA (size: 16388 bases) GC AT G C A T
Base content (bases) 6378 10010 4277 2101 4610 5400
Base content per 1 kb (bases) 389 611 261 128 281 330
Base content (%) 38.9% 61.1%
Total protein-coding genes (size: 11346 bases) GC AT G C A T
Base content (bases) 4461 6885 3182 1279 3254 3631
Base content per 1 kb (bases) 393 607 280 113 287 320
Base content (%) 39.3% 60.7%
D-loop (size: 917 bases) GC AT G C A T
Base content (bases) 349 568 223 126 296 272
Base content per 1 kb (bases) 381 619 243 137 323 297
Base content (%) 38.1% 61.9%
Total tRNA-coding genes (size: 1515 bases) GC AT G C A T
Base content (bases) 548 967 315 233 428 539
Base content per 1 kb (bases) 362 638 208 154 283 356
Base content (%) 36.2% 63.8%
Total rRNA-coding genes (size: 2551 bases) GC AT G C A T
Base content (bases) 993 1558 541 452 620 938
Base content per 1 kb (bases) 389 611 212 177 243 368
Base content (%) 38.9% 61.1%
12S rRNA gene (size: 974 bases) GC AT G C A T
Base content (bases) 405 569 226 179 217 352
Base content per 1 kb (bases) 416 584 232 184 223 361
Base content (%) 41.6% 58.4%
16S rRNA gene (size: 1577 bases) GC AT G C A T
Base content (bases) 588 989 315 273 403 586
Base content per 1 kb (bases) 373 627 200 173 256 372
Base content (%) 37.3% 62.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 266 415 194 72 204 211
Base content per 1 kb (bases) 391 609 285 106 300 310
Base content (%) 39.1% 60.9%
ATP8 (size: 192 bases) GC AT G C A T
Base content (bases) 72 120 59 13 52 68
Base content per 1 kb (bases) 375 625 307 68 271 354
Base content (%) 37.5% 62.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 613 938 366 247 490 448
Base content per 1 kb (bases) 395 605 236 159 316 289
Base content (%) 39.5% 60.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 261 423 169 92 193 230
Base content per 1 kb (bases) 382 618 247 135 282 336
Base content (%) 38.2% 61.8%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 325 460 221 104 238 222
Base content per 1 kb (bases) 414 586 282 132 303 283
Base content (%) 41.4% 58.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 483 657 339 144 312 345
Base content per 1 kb (bases) 424 576 297 126 274 303
Base content (%) 42.4% 57.6%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 384 573 275 109 263 310
Base content per 1 kb (bases) 401 599 287 114 275 324
Base content (%) 40.1% 59.9%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 402 640 319 83 278 362
Base content per 1 kb (bases) 386 614 306 80 267 347
Base content (%) 38.6% 61.4%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 133 213 96 37 105 108
Base content per 1 kb (bases) 384 616 277 107 303 312
Base content (%) 38.4% 61.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 523 855 385 138 417 438
Base content per 1 kb (bases) 380 620 279 100 303 318
Base content (%) 38.0% 62.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 115 182 79 36 94 88
Base content per 1 kb (bases) 387 613 266 121 316 296
Base content (%) 38.7% 61.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 708 1113 537 171 513 600
Base content per 1 kb (bases) 389 611 295 94 282 329
Base content (%) 38.9% 61.1%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 193 335 154 39 113 222
Base content per 1 kb (bases) 366 634 292 74 214 420
Base content (%) 36.6% 63.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 15 (6.64%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 11 8 5 22 1 7 7 1 1 2 5 1 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 7 3 4 2 2 4 3 0 4 4 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 12 0 3 2 3 0 0 5 0 2 0 2 8 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 4 1 1 1 1 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 66 85 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 62 36 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 66 90 58
ATP8 (size: 192 bases)
Amino acid sequence: MPQLDTSTWLLTILSMIFTLFALLQLKISKHFYSPSPKPVDTKLQKQQTPWNHTWTKIYLPLS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.59%)
Serine (Ser, S)
n = 6 (9.52%)
Threonine (Thr, T)
n = 8 (12.7%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.59%)
Leucine (Leu, L)
n = 11 (17.46%)
Isoleucine (Ile, I)
n = 4 (6.35%)
Methionine (Met, M)
n = 2 (3.17%)
Proline (Pro, P)
n = 6 (9.52%)
Phenylalanine (Phe, F)
n = 3 (4.76%)
Tyrosine (Tyr, Y)
n = 2 (3.17%)
Tryptophan (Trp, W)
n = 3 (4.76%)
Aspartic acid (Asp, D)
n = 2 (3.17%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 1 (1.59%)
Glutamine (Gln, Q)
n = 5 (7.94%)
Histidine (His, H)
n = 2 (3.17%)
Lysine (Lys, K)
n = 6 (9.52%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 1 3 2 4 1 0 5 0 0 0 1 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 4 0 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 1 2 1 3 0 0 0 1 1 1 1 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 1 1 5 1 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 23 21 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 19 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 15 28 15
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.3%)
Alanine (Ala, A)
n = 38 (7.36%)
Serine (Ser, S)
n = 31 (6.01%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.17%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 30 (5.81%)
Proline (Pro, P)
n = 29 (5.62%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 19 (3.68%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 17 (3.29%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 15 26 9 4 29 2 16 6 1 11 7 15 4 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 12 10 14 2 13 10 22 3 14 5 9 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 22 0 8 4 16 0 2 1 13 6 2 2 7 12 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 1 3 12 9 0 2 1 5 0 1 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 105 140 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 133 95 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 128 213 154
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 10 (4.41%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 5 12 3 3 16 1 10 8 0 5 4 5 0 6 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 3 2 5 0 1 5 2 0 6 3 3 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 0 4 4 7 0 1 3 4 5 0 1 3 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 2 3 8 5 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 56 65 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 61 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 58 104 56
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 13 (5.0%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 11 12 3 12 13 0 4 6 1 3 4 7 0 7 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 5 6 2 0 5 8 6 0 4 1 6 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 1 4 2 11 0 4 1 7 4 0 0 3 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 0 3 0 1 1 2 0 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 69 65 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 64 55 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 88 101 67
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 29 (7.65%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 64 (16.89%)
Isoleucine (Ile, I)
n = 36 (9.5%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 27 14 6 9 31 1 16 7 1 1 8 5 1 7 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 3 6 15 2 4 10 11 0 5 6 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 12 1 4 8 6 0 0 3 8 8 0 1 6 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 1 4 7 9 0 1 2 5 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 97 108 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 76 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 146 161 64
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 30 (9.43%)
Serine (Ser, S)
n = 20 (6.29%)
Threonine (Thr, T)
n = 23 (7.23%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 12 (3.77%)
Leucine (Leu, L)
n = 57 (17.92%)
Isoleucine (Ile, I)
n = 23 (7.23%)
Methionine (Met, M)
n = 22 (6.92%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 21 (6.6%)
Tyrosine (Tyr, Y)
n = 10 (3.14%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 8 (2.52%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 15 21 4 10 33 1 9 6 0 0 2 10 0 7 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 12 6 12 0 2 5 6 0 4 8 8 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 14 1 3 7 9 0 0 1 4 6 0 0 3 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 0 4 7 1 1 0 7 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 88 90 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 94 57 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 93 163 57
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 46 (13.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 29 (8.38%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 17 28 5 14 36 0 7 11 0 3 2 3 0 10 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 5 9 7 0 2 2 8 0 5 9 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 23 2 2 11 7 1 0 4 2 7 0 1 4 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 1 11 1 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 96 140 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 110 56 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 113 166 62
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 46 (13.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 29 (8.38%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 17 28 5 14 36 0 7 11 0 3 2 3 0 10 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 5 9 7 0 2 2 8 0 5 9 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 23 2 2 11 7 1 0 4 2 7 0 1 4 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 1 11 1 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 96 140 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 110 56 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 113 166 62
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 96 (20.96%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 20 33 19 17 37 2 20 10 1 0 6 8 0 11 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 8 9 14 0 1 7 8 1 11 7 4 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 18 0 7 8 10 0 4 6 8 8 0 1 5 16 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 1 2 1 10 1 2 2 6 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 131 155 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 116 84 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 138 199 112
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 6 (6.12%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 4 2 4 7 0 10 2 0 1 3 4 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 5 4 0 1 2 1 0 0 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 0 1 4 1 0 0 0 2 1 0 0 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 20 27 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 24 18 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 35 43 18
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.29%)
Alanine (Ala, A)
n = 39 (6.44%)
Serine (Ser, S)
n = 44 (7.26%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 11 (1.82%)
Leucine (Leu, L)
n = 98 (16.17%)
Isoleucine (Ile, I)
n = 58 (9.57%)
Methionine (Met, M)
n = 38 (6.27%)
Proline (Pro, P)
n = 29 (4.79%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 35 33 13 22 44 2 16 18 0 0 4 6 1 14 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 11 17 11 0 3 8 15 0 9 13 7 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 32 0 10 12 11 1 0 10 6 14 0 1 13 22 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 2 3 8 24 0 2 4 2 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 150 223 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
60 160 135 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 227 242 126
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.0%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 20 (11.43%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 1 3 2 0 0 1 11 0 1 13 0 5 7 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 5 0 2 0 9 2 7 10 2 0 0 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 4 0 2 1 4 1 8 1 3 6 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 2 1 3 0 0 0 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 8 45 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 25 29 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 6 39 87
Total protein-coding genes (size: 11402 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 212 (5.58%)
Alanine (Ala, A)
n = 253 (6.66%)
Serine (Ser, S)
n = 259 (6.82%)
Threonine (Thr, T)
n = 330 (8.69%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 169 (4.45%)
Leucine (Leu, L)
n = 635 (16.72%)
Isoleucine (Ile, I)
n = 319 (8.4%)
Methionine (Met, M)
n = 238 (6.27%)
Proline (Pro, P)
n = 201 (5.29%)
Phenylalanine (Phe, F)
n = 247 (6.5%)
Tyrosine (Tyr, Y)
n = 129 (3.4%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 70 (1.84%)
Glutamic acid (Glu, E)
n = 91 (2.4%)
Asparagine (Asn, N)
n = 158 (4.16%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
151 168 202 85 103 287 12 131 89 6 39 42 74 14 106 141
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
36 8 14 74 78 95 6 43 65 90 14 70 59 66 6 66
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
90 167 7 53 65 86 3 15 37 65 64 6 17 61 97 34
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
62 77 14 24 46 92 6 11 13 38 2 2 0 7 0 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
795 943 1197 864
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
456 991 744 1608
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
149 1144 1601 905

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.