Viewing data for Abramis brama


Scientific name Abramis brama
Common name Bream
Maximum lifespan 23.00 years (Abramis brama@AnAge)

Total mtDNA (size: 16607 bases) GC AT G C A T
Base content (bases) 7148 9459 4387 2761 4451 5008
Base content per 1 kb (bases) 430 570 264 166 268 302
Base content (%) 43.0% 57.0%
Total protein-coding genes (size: 11403 bases) GC AT G C A T
Base content (bases) 4895 6508 3175 1720 3167 3341
Base content per 1 kb (bases) 429 571 278 151 278 293
Base content (%) 42.9% 57.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1561 bases) GC AT G C A T
Base content (bases) 693 868 372 321 402 466
Base content per 1 kb (bases) 444 556 238 206 258 299
Base content (%) 44.4% 55.6%
Total rRNA-coding genes (size: 2650 bases) GC AT G C A T
Base content (bases) 1208 1442 632 576 559 883
Base content per 1 kb (bases) 456 544 238 217 211 333
Base content (%) 45.6% 54.4%
12S rRNA gene (size: 959 bases) GC AT G C A T
Base content (bases) 472 487 251 221 194 293
Base content per 1 kb (bases) 492 508 262 230 202 306
Base content (%) 49.2% 50.8%
16S rRNA gene (size: 1691 bases) GC AT G C A T
Base content (bases) 736 955 381 355 365 590
Base content per 1 kb (bases) 435 565 225 210 216 349
Base content (%) 43.5% 56.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 277 407 183 94 204 203
Base content per 1 kb (bases) 405 595 268 137 298 297
Base content (%) 40.5% 59.5%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 69 96 50 19 36 60
Base content per 1 kb (bases) 418 582 303 115 218 364
Base content (%) 41.8% 58.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 666 885 387 279 472 413
Base content per 1 kb (bases) 429 571 250 180 304 266
Base content (%) 42.9% 57.1%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 286 405 171 115 200 205
Base content per 1 kb (bases) 414 586 247 166 289 297
Base content (%) 41.4% 58.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 351 433 213 138 226 207
Base content per 1 kb (bases) 448 552 272 176 288 264
Base content (%) 44.8% 55.2%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 476 665 312 164 336 329
Base content per 1 kb (bases) 417 583 273 144 294 288
Base content (%) 41.7% 58.3%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 439 536 283 156 269 267
Base content per 1 kb (bases) 450 550 290 160 276 274
Base content (%) 45.0% 55.0%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 462 583 315 147 271 312
Base content per 1 kb (bases) 442 558 301 141 259 299
Base content (%) 44.2% 55.8%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 141 208 92 49 110 98
Base content per 1 kb (bases) 404 596 264 140 315 281
Base content (%) 40.4% 59.6%
ND4 (size: 1382 bases) GC AT G C A T
Base content (bases) 591 791 388 203 389 402
Base content per 1 kb (bases) 428 572 281 147 281 291
Base content (%) 42.8% 57.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 138 159 90 48 81 78
Base content per 1 kb (bases) 465 535 303 162 273 263
Base content (%) 46.5% 53.5%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 770 1066 524 246 499 567
Base content per 1 kb (bases) 419 581 285 134 272 309
Base content (%) 41.9% 58.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 233 289 168 65 80 209
Base content per 1 kb (bases) 446 554 322 125 153 400
Base content (%) 44.6% 55.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 21 (9.25%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 19 (8.37%)
Leucine (Leu, L)
n = 47 (20.7%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 4 6 11 5 18 5 8 7 1 4 2 13 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 8 7 1 0 3 7 0 2 1 15 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 0 2 1 0 0 0 4 1 2 1 0 6 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 1 0 0 0 4 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 74 66 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 61 31 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 48 106 60
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWFAILVFSWIVFLTIIPTKILNHTAPNEPAPMSEEKHKTEPWNWPW*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.56%)
Serine (Ser, S)
n = 2 (3.7%)
Threonine (Thr, T)
n = 4 (7.41%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.7%)
Leucine (Leu, L)
n = 4 (7.41%)
Isoleucine (Ile, I)
n = 5 (9.26%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 9 (16.67%)
Phenylalanine (Phe, F)
n = 3 (5.56%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (7.41%)
Asparagine (Asn, N)
n = 5 (9.26%)
Glutamine (Gln, Q)
n = 1 (1.85%)
Histidine (His, H)
n = 2 (3.7%)
Lysine (Lys, K)
n = 3 (5.56%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 1 0 2 1 0 1 1 0 0 1 1 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 1 3 4 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 0 0 1 0 1 0 0 0 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 0 0 3 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
9 15 20 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 17 16 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 24 9
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 49 (9.5%)
Serine (Ser, S)
n = 29 (5.62%)
Threonine (Thr, T)
n = 34 (6.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.53%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 16 (3.1%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 18 (3.49%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 6 14 18 11 19 1 12 7 1 11 6 19 8 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 9 26 13 1 11 8 20 7 3 6 18 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 21 1 6 3 15 1 0 4 8 10 2 1 7 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 2 7 8 8 0 2 1 3 2 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
165 111 124 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 140 194 145
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 22 (9.61%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 17 (7.42%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 5 9 6 3 10 0 10 8 0 7 5 9 1 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 3 8 3 2 3 1 3 2 2 5 6 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 1 3 5 4 1 1 3 8 1 0 0 3 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 1 4 9 2 2 2 1 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 57 51 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 53 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 61 91 64
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 4 6 7 5 14 2 3 7 2 2 4 7 4 9 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 7 7 7 1 3 6 12 1 4 1 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 4 3 4 0 0 3 4 7 1 0 1 0 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 3 1 4 1 1 3 0 1 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 70 52 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 67 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 76 101 66
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 24 (6.33%)
Leucine (Leu, L)
n = 62 (16.36%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 8 9 10 13 23 1 14 6 1 6 7 8 3 12 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 3 7 18 0 2 10 11 3 3 2 15 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 8 2 3 6 11 1 1 1 5 10 0 1 8 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 2 9 9 0 1 0 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 95 95 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 96 77 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 121 157 84
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.86%)
Alanine (Ala, A)
n = 33 (10.19%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 19 (5.86%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 22 (6.79%)
Leucine (Leu, L)
n = 62 (19.14%)
Isoleucine (Ile, I)
n = 19 (5.86%)
Methionine (Met, M)
n = 13 (4.01%)
Proline (Pro, P)
n = 23 (7.1%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 4 10 13 9 24 7 7 7 0 3 7 8 4 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 14 16 1 2 4 10 3 9 9 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 6 3 1 6 12 0 2 2 6 6 1 2 3 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 2 2 2 6 1 0 1 6 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 96 74 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 94 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 93 134 70
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 22 (6.34%)
Methionine (Met, M)
n = 21 (6.05%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 8 (2.31%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 9 16 14 9 22 7 15 13 1 5 3 6 1 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 8 15 15 2 1 4 11 1 5 10 3 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 15 2 3 6 5 2 1 7 4 4 0 2 3 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 2 1 8 1 1 0 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 95 112 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 119 53 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 101 147 74
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 40 (11.53%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 22 (6.34%)
Methionine (Met, M)
n = 21 (6.05%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 8 (2.31%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 9 16 14 9 22 7 15 13 1 5 3 6 1 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 8 15 15 2 1 4 11 1 5 10 3 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 15 2 3 6 5 2 1 7 4 4 0 2 3 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 2 1 8 1 1 0 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 95 112 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 119 53 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 101 147 74
ND4 (size: 1382 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (6.54%)
Alanine (Ala, A)
n = 33 (7.19%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 42 (9.15%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 18 (3.92%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 27 (5.88%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 8 (1.74%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 15 21 21 15 27 3 16 9 3 4 2 12 0 7 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 4 2 17 10 4 2 10 15 3 7 5 15 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 2 9 8 5 1 1 6 4 10 3 4 3 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 3 0 4 10 1 0 3 8 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 129 137 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 126 72 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 133 192 101
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 4 2 3 13 2 3 3 0 0 0 2 0 6 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 5 4 1 0 2 1 2 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 2 2 2 2 0 1 3 0 0 0 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 0 1 0 0 0 3 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 32 22 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 29 14 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 29 42 19
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.24%)
Alanine (Ala, A)
n = 55 (9.0%)
Serine (Ser, S)
n = 42 (6.87%)
Threonine (Thr, T)
n = 58 (9.49%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 28 (4.58%)
Leucine (Leu, L)
n = 93 (15.22%)
Isoleucine (Ile, I)
n = 50 (8.18%)
Methionine (Met, M)
n = 35 (5.73%)
Proline (Pro, P)
n = 28 (4.58%)
Phenylalanine (Phe, F)
n = 41 (6.71%)
Tyrosine (Tyr, Y)
n = 13 (2.13%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 29 (4.75%)
Glutamine (Gln, Q)
n = 19 (3.11%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 21 (3.44%)
Arginine (Arg, R)
n = 11 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 18 28 19 14 37 6 16 16 3 7 9 10 2 15 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 2 7 27 19 2 2 8 18 4 9 9 9 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 23 3 7 9 11 2 1 12 6 7 0 1 9 20 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 0 5 7 20 1 0 2 8 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
138 148 206 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 170 120 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 206 241 132
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.45%)
Alanine (Ala, A)
n = 19 (10.98%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 27 (15.61%)
Leucine (Leu, L)
n = 30 (17.34%)
Isoleucine (Ile, I)
n = 6 (3.47%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 10 (5.78%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 3 6 0 4 1 11 0 0 12 0 7 8 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 9 2 5 3 8 2 4 11 2 1 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 2 5 1 0 2 2 0 8 0 3 8 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 2 0 0 1 1 0 0 4 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 20 22 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 36 18 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 9 40 75
Total protein-coding genes (size: 11422 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 248 (6.52%)
Alanine (Ala, A)
n = 340 (8.94%)
Serine (Ser, S)
n = 237 (6.23%)
Threonine (Thr, T)
n = 300 (7.89%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 243 (6.39%)
Leucine (Leu, L)
n = 622 (16.35%)
Isoleucine (Ile, I)
n = 276 (7.26%)
Methionine (Met, M)
n = 181 (4.76%)
Proline (Pro, P)
n = 214 (5.63%)
Phenylalanine (Phe, F)
n = 229 (6.02%)
Tyrosine (Tyr, Y)
n = 113 (2.97%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 102 (2.68%)
Asparagine (Asn, N)
n = 116 (3.05%)
Glutamine (Gln, Q)
n = 99 (2.6%)
Histidine (His, H)
n = 103 (2.71%)
Lysine (Lys, K)
n = 77 (2.02%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
198 78 129 130 94 222 35 122 87 12 61 47 103 32 106 123
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 14 12 58 140 124 18 34 59 117 38 50 54 102 8 52
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
99 131 18 47 52 72 10 11 45 56 57 12 19 47 69 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 86 16 27 48 69 8 10 11 44 12 0 0 6 1 108
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1008 974 1006 817
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
527 1035 692 1551
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
291 1064 1522 928

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.