Viewing data for Anguilla reinhardtii


Scientific name Anguilla reinhardtii
Common name Speckled longfin eel
Maximum lifespan 41.00 years (Anguilla reinhardtii@AnAge)

Total mtDNA (size: 16690 bases) GC AT G C A T
Base content (bases) 6933 9757 4360 2573 4108 5649
Base content per 1 kb (bases) 415 585 261 154 246 338
Base content (%) 41.5% 58.5%
Total protein-coding genes (size: 11447 bases) GC AT G C A T
Base content (bases) 4750 6697 3149 1601 2920 3777
Base content per 1 kb (bases) 415 585 275 140 255 330
Base content (%) 41.5% 58.5%
D-loop (size: 967 bases) GC AT G C A T
Base content (bases) 316 651 190 126 277 374
Base content per 1 kb (bases) 327 673 196 130 286 387
Base content (%) 32.7% 67.3%
Total tRNA-coding genes (size: 1563 bases) GC AT G C A T
Base content (bases) 676 887 378 298 382 505
Base content per 1 kb (bases) 433 567 242 191 244 323
Base content (%) 43.3% 56.7%
Total rRNA-coding genes (size: 2660 bases) GC AT G C A T
Base content (bases) 1168 1492 631 537 519 973
Base content per 1 kb (bases) 439 561 237 202 195 366
Base content (%) 43.9% 56.1%
12S rRNA gene (size: 949 bases) GC AT G C A T
Base content (bases) 441 508 239 202 187 321
Base content per 1 kb (bases) 465 535 252 213 197 338
Base content (%) 46.5% 53.5%
16S rRNA gene (size: 1711 bases) GC AT G C A T
Base content (bases) 727 984 392 335 332 652
Base content per 1 kb (bases) 425 575 229 196 194 381
Base content (%) 42.5% 57.5%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 274 409 189 85 196 213
Base content per 1 kb (bases) 401 599 277 124 287 312
Base content (%) 40.1% 59.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 45 24 41 58
Base content per 1 kb (bases) 411 589 268 143 244 345
Base content (%) 41.1% 58.9%
COX1 (size: 1593 bases) GC AT G C A T
Base content (bases) 690 903 411 279 442 461
Base content per 1 kb (bases) 433 567 258 175 277 289
Base content (%) 43.3% 56.7%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 295 396 179 116 171 225
Base content per 1 kb (bases) 427 573 259 168 247 326
Base content (%) 42.7% 57.3%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 341 444 215 126 209 235
Base content per 1 kb (bases) 434 566 274 161 266 299
Base content (%) 43.4% 56.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 487 653 323 164 312 341
Base content per 1 kb (bases) 427 573 283 144 274 299
Base content (%) 42.7% 57.3%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 420 552 285 135 240 312
Base content per 1 kb (bases) 432 568 293 139 247 321
Base content (%) 43.2% 56.8%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 410 635 285 125 228 407
Base content per 1 kb (bases) 392 608 273 120 218 389
Base content (%) 39.2% 60.8%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 148 201 101 47 104 97
Base content per 1 kb (bases) 424 576 289 135 298 278
Base content (%) 42.4% 57.6%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 564 817 381 183 355 462
Base content per 1 kb (bases) 408 592 276 133 257 335
Base content (%) 40.8% 59.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 88 38 86 85
Base content per 1 kb (bases) 424 576 296 128 290 286
Base content (%) 42.4% 57.6%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 719 1123 495 224 470 653
Base content per 1 kb (bases) 390 610 269 122 255 355
Base content (%) 39.0% 61.0%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 212 310 155 57 72 238
Base content per 1 kb (bases) 406 594 297 109 138 456
Base content (%) 40.6% 59.4%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (7.08%)
Leucine (Leu, L)
n = 52 (23.01%)
Isoleucine (Ile, I)
n = 17 (7.52%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 16 (7.08%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 6 8 6 7 22 6 11 9 0 4 2 10 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 4 6 2 1 2 7 0 2 3 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 0 2 2 0 0 2 3 1 2 0 0 3 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 1 0 1 0 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 75 69 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 30 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 54 113 47
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFTILVFSWAVFLAILPTKVMAHTFNNEPNLQTAKKPKMDSWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 2 1 0 1 1 2 1 1 0 0 1 2 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 2 0 0 0 0 0 0 3 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 1 0 1 0 0 0 0 1 1 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 1 0 4 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 13 18 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 18 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 14 24 9
COX1 (size: 1593 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.06%)
Alanine (Ala, A)
n = 47 (8.87%)
Serine (Ser, S)
n = 27 (5.09%)
Threonine (Thr, T)
n = 38 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.3%)
Leucine (Leu, L)
n = 62 (11.7%)
Isoleucine (Ile, I)
n = 38 (7.17%)
Methionine (Met, M)
n = 23 (4.34%)
Proline (Pro, P)
n = 30 (5.66%)
Phenylalanine (Phe, F)
n = 41 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.58%)
Tryptophan (Trp, W)
n = 18 (3.4%)
Aspartic acid (Asp, D)
n = 17 (3.21%)
Glutamic acid (Glu, E)
n = 14 (2.64%)
Asparagine (Asn, N)
n = 14 (2.64%)
Glutamine (Gln, Q)
n = 9 (1.7%)
Histidine (His, H)
n = 20 (3.77%)
Lysine (Lys, K)
n = 11 (2.08%)
Arginine (Arg, R)
n = 9 (1.7%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 17 19 13 5 26 5 13 9 0 6 9 27 2 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 12 20 13 2 6 9 24 9 4 6 17 3 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 20 0 4 5 14 0 1 3 7 12 0 0 5 9 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 12 2 5 12 11 0 3 1 5 0 0 1 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
170 117 129 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 138 104 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 156 228 119
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 19 (8.3%)
Serine (Ser, S)
n = 14 (6.11%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 9 4 2 18 1 2 8 1 5 3 9 4 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 0 5 13 1 1 1 6 1 1 4 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 2 2 6 1 0 3 3 6 0 0 2 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 0 2 11 3 0 0 1 4 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 64 52 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 63 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 61 110 44
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 29 (11.15%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 4 9 3 3 15 1 7 9 0 5 4 8 1 6 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 10 8 0 2 7 10 2 1 2 8 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 1 0 2 8 0 0 3 5 7 1 0 0 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 0 2 3 3 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 63 56 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 85 123 45
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 28 (7.39%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 26 (6.86%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 14 13 11 7 29 4 8 6 0 3 5 18 2 8 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 6 11 9 1 3 5 15 3 1 2 18 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 2 9 12 1 0 0 6 10 1 1 3 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 1 3 8 8 1 0 1 7 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 99 90 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 93 81 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 131 170 62
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 33 (10.22%)
Serine (Ser, S)
n = 18 (5.57%)
Threonine (Thr, T)
n = 22 (6.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (5.57%)
Leucine (Leu, L)
n = 60 (18.58%)
Isoleucine (Ile, I)
n = 24 (7.43%)
Methionine (Met, M)
n = 15 (4.64%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 16 (4.95%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.72%)
Asparagine (Asn, N)
n = 16 (4.95%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 15 12 9 5 32 5 8 5 0 2 2 14 0 8 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 19 12 0 0 6 10 2 4 2 16 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 1 1 4 11 0 0 2 3 9 1 1 1 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 12 0 0 3 8 0 2 0 6 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 91 87 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 95 60 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 99 165 45
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 19 (5.48%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 26 (7.49%)
Methionine (Met, M)
n = 37 (10.66%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 13 31 5 5 34 2 7 15 0 0 1 9 0 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 6 12 13 1 3 2 12 2 0 3 13 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 31 1 1 2 12 0 0 4 3 5 1 1 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 0 0 2 12 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 90 137 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 112 61 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 83 209 39
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 19 (5.48%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.88%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 26 (7.49%)
Methionine (Met, M)
n = 37 (10.66%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 10 (2.88%)
Glutamine (Gln, Q)
n = 15 (4.32%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 13 31 5 5 34 2 7 15 0 0 1 9 0 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 6 12 13 1 3 2 12 2 0 3 13 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 31 1 1 2 12 0 0 4 3 5 1 1 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 0 0 2 12 1 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 90 137 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 112 61 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 83 209 39
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 34 (7.41%)
Serine (Ser, S)
n = 27 (5.88%)
Threonine (Thr, T)
n = 41 (8.93%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 6 (1.31%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.83%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 18 23 9 11 49 3 14 11 0 3 2 10 1 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 2 2 15 16 1 2 8 17 2 2 4 18 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 0 1 9 12 0 1 4 6 9 0 0 0 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 11 1 1 5 12 1 0 3 9 0 0 0 0 0 20
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 129 142 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 121 79 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 131 241 73
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 8 (8.16%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 7 2 2 11 1 3 2 0 0 0 2 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 2 7 3 0 1 2 1 0 0 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 1 3 6 0 1 1 0 1 1 1 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 1 0 1 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 27 22 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 32 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 29 47 19
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 50 (8.16%)
Serine (Ser, S)
n = 36 (5.87%)
Threonine (Thr, T)
n = 56 (9.14%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 28 (4.57%)
Leucine (Leu, L)
n = 88 (14.36%)
Isoleucine (Ile, I)
n = 53 (8.65%)
Methionine (Met, M)
n = 40 (6.53%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 40 (6.53%)
Tyrosine (Tyr, Y)
n = 13 (2.12%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 34 (5.55%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 12 (1.96%)
Lysine (Lys, K)
n = 26 (4.24%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 26 32 9 13 48 1 17 22 0 4 8 16 0 15 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 3 3 7 24 19 0 4 7 19 1 2 5 22 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 32 3 4 5 16 0 1 10 3 10 1 0 8 26 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 2 6 7 25 1 0 0 8 1 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
134 144 220 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 161 133 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 190 300 105
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 21 (12.14%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 8 (4.62%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 15 (8.67%)
Tyrosine (Tyr, Y)
n = 13 (7.51%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 2 1 8 0 0 2 11 0 0 10 0 2 9 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 5 0 10 2 4 0 8 1 3 12 4 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 1 2 4 0 11 2 2 7 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 5 0 0 0 4 0 1 1 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 20 19 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 30 25 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 7 28 98
Total protein-coding genes (size: 11468 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 245 (6.42%)
Alanine (Ala, A)
n = 317 (8.3%)
Serine (Ser, S)
n = 221 (5.79%)
Threonine (Thr, T)
n = 304 (7.96%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 229 (6.0%)
Leucine (Leu, L)
n = 593 (15.53%)
Isoleucine (Ile, I)
n = 282 (7.38%)
Methionine (Met, M)
n = 212 (5.55%)
Proline (Pro, P)
n = 212 (5.55%)
Phenylalanine (Phe, F)
n = 233 (6.1%)
Tyrosine (Tyr, Y)
n = 124 (3.25%)
Tryptophan (Trp, W)
n = 121 (3.17%)
Aspartic acid (Asp, D)
n = 83 (2.17%)
Glutamic acid (Glu, E)
n = 104 (2.72%)
Asparagine (Asn, N)
n = 132 (3.46%)
Glutamine (Gln, Q)
n = 102 (2.67%)
Histidine (His, H)
n = 99 (2.59%)
Lysine (Lys, K)
n = 93 (2.44%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
155 127 169 84 64 296 34 104 99 3 42 37 129 21 97 136
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 16 14 56 132 121 8 32 50 129 34 24 37 139 12 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
88 164 8 24 46 104 4 10 33 50 74 9 11 30 102 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
70 94 10 26 57 89 4 11 8 55 3 0 1 5 1 112
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
978 968 1067 807
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
517 1011 743 1549
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
206 1075 1809 730

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.