Viewing data for Ateles belzebuth


Scientific name Ateles belzebuth
Common name White-bellied spider monkey
Maximum lifespan 37.00 years (Ateles belzebuth@AnAge)

Total mtDNA (size: 16560 bases) GC AT G C A T
Base content (bases) 6473 10087 4382 2091 4578 5509
Base content per 1 kb (bases) 391 609 265 126 276 333
Base content (%) 39.1% 60.9%
Total protein-coding genes (size: 11334 bases) GC AT G C A T
Base content (bases) 4440 6894 3155 1285 3235 3659
Base content per 1 kb (bases) 392 608 278 113 285 323
Base content (%) 39.2% 60.8%
D-loop (size: 1140 bases) GC AT G C A T
Base content (bases) 464 676 317 147 281 395
Base content per 1 kb (bases) 407 593 278 129 246 346
Base content (%) 40.7% 59.3%
Total tRNA-coding genes (size: 1504 bases) GC AT G C A T
Base content (bases) 548 956 320 228 429 527
Base content per 1 kb (bases) 364 636 213 152 285 350
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2509 bases) GC AT G C A T
Base content (bases) 993 1516 570 423 608 908
Base content per 1 kb (bases) 396 604 227 169 242 362
Base content (%) 39.6% 60.4%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 392 563 220 172 222 341
Base content per 1 kb (bases) 410 590 230 180 232 357
Base content (%) 41.0% 59.0%
16S rRNA gene (size: 1554 bases) GC AT G C A T
Base content (bases) 601 953 350 251 386 567
Base content per 1 kb (bases) 387 613 225 162 248 365
Base content (%) 38.7% 61.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 261 420 196 65 199 221
Base content per 1 kb (bases) 383 617 288 95 292 325
Base content (%) 38.3% 61.7%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 58 143 44 14 60 83
Base content per 1 kb (bases) 289 711 219 70 299 413
Base content (%) 28.9% 71.1%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 630 927 390 240 477 450
Base content per 1 kb (bases) 405 595 250 154 306 289
Base content (%) 40.5% 59.5%
COX2 (size: 674 bases) GC AT G C A T
Base content (bases) 269 405 179 90 190 215
Base content per 1 kb (bases) 399 601 266 134 282 319
Base content (%) 39.9% 60.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 340 444 231 109 212 232
Base content per 1 kb (bases) 434 566 295 139 270 296
Base content (%) 43.4% 56.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 483 657 345 138 327 330
Base content per 1 kb (bases) 424 576 303 121 287 289
Base content (%) 42.4% 57.6%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 366 589 266 100 274 315
Base content per 1 kb (bases) 383 617 279 105 287 330
Base content (%) 38.3% 61.7%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 374 665 293 81 290 375
Base content per 1 kb (bases) 360 640 282 78 279 361
Base content (%) 36.0% 64.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 115 231 82 33 110 121
Base content per 1 kb (bases) 332 668 237 95 318 350
Base content (%) 33.2% 66.8%
ND4 (size: 1372 bases) GC AT G C A T
Base content (bases) 533 839 387 146 397 442
Base content per 1 kb (bases) 388 612 282 106 289 322
Base content (%) 38.8% 61.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 104 193 69 35 103 90
Base content per 1 kb (bases) 350 650 232 118 347 303
Base content (%) 35.0% 65.0%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 715 1091 526 189 503 588
Base content per 1 kb (bases) 396 604 291 105 279 326
Base content (%) 39.6% 60.4%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 208 326 158 50 109 217
Base content per 1 kb (bases) 390 610 296 94 204 406
Base content (%) 39.0% 61.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 14 (6.19%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 49 (21.68%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 9 (3.98%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 12 13 7 6 24 1 11 8 1 2 2 6 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 6 5 0 1 2 6 0 2 7 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 3 6 2 1 0 4 3 1 0 0 8 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 5 0 0 0 2 2 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 69 81 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 61 38 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 66 102 51
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDLSPWPVVILSMIMTLFYIIQLKMLNFTFYITPLSKLTKMQKHKTTWELKWTKIYLPPSMCQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 7 (10.61%)
Cysteine (Cys, C)
n = 1 (1.52%)
Valine (Val, V)
n = 2 (3.03%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 6 (9.09%)
Methionine (Met, M)
n = 6 (9.09%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 3 (4.55%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 1 (1.52%)
Asparagine (Asn, N)
n = 1 (1.52%)
Glutamine (Gln, Q)
n = 4 (6.06%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 7 (10.61%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 4 0 0 3 2 4 4 0 0 0 1 1 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 0 0 0 0 0 0 0 0 2 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 0 4 0 0 0 3 0 0 1 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 1 0 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 16 27 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 17 19 27
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 11 37 13
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.88%)
Alanine (Ala, A)
n = 38 (7.34%)
Serine (Ser, S)
n = 34 (6.56%)
Threonine (Thr, T)
n = 38 (7.34%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.76%)
Leucine (Leu, L)
n = 61 (11.78%)
Isoleucine (Ile, I)
n = 40 (7.72%)
Methionine (Met, M)
n = 31 (5.98%)
Proline (Pro, P)
n = 28 (5.41%)
Phenylalanine (Phe, F)
n = 42 (8.11%)
Tyrosine (Tyr, Y)
n = 21 (4.05%)
Tryptophan (Trp, W)
n = 16 (3.09%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 11 (2.12%)
Asparagine (Asn, N)
n = 17 (3.28%)
Glutamine (Gln, Q)
n = 6 (1.16%)
Histidine (His, H)
n = 19 (3.67%)
Lysine (Lys, K)
n = 11 (2.12%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 13 26 8 13 24 3 13 6 0 7 8 20 0 23 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 10 14 13 1 10 10 20 6 6 11 11 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 0 8 6 16 0 1 3 11 10 0 0 9 8 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 2 6 9 10 1 1 2 5 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
145 109 142 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 100 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 147 208 145
COX2 (size: 674 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.59%)
Alanine (Ala, A)
n = 16 (7.17%)
Serine (Ser, S)
n = 18 (8.07%)
Threonine (Thr, T)
n = 13 (5.83%)
Cysteine (Cys, C)
n = 2 (0.9%)
Valine (Val, V)
n = 8 (3.59%)
Leucine (Leu, L)
n = 28 (12.56%)
Isoleucine (Ile, I)
n = 23 (10.31%)
Methionine (Met, M)
n = 15 (6.73%)
Proline (Pro, P)
n = 12 (5.38%)
Phenylalanine (Phe, F)
n = 11 (4.93%)
Tyrosine (Tyr, Y)
n = 11 (4.93%)
Tryptophan (Trp, W)
n = 5 (2.24%)
Aspartic acid (Asp, D)
n = 10 (4.48%)
Glutamic acid (Glu, E)
n = 13 (5.83%)
Asparagine (Asn, N)
n = 6 (2.69%)
Glutamine (Gln, Q)
n = 8 (3.59%)
Histidine (His, H)
n = 7 (3.14%)
Lysine (Lys, K)
n = 4 (1.79%)
Arginine (Arg, R)
n = 6 (2.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 13 14 7 2 12 1 6 6 2 1 3 3 1 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 4 7 5 0 2 2 3 1 3 3 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 2 2 8 2 1 3 4 7 0 0 3 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 12 1 4 6 3 1 2 2 2 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 55 65 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 59 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 69 90 55
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 10 (3.85%)
Leucine (Leu, L)
n = 28 (10.77%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 8 11 2 6 14 0 6 9 0 2 2 6 0 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 4 8 7 0 2 8 7 2 1 4 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 0 3 6 5 1 2 3 7 6 0 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 1 2 1 0 1 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 63 67 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 70 56 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 98 109 48
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 35 (9.23%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 13 (3.43%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 24 (6.33%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 3 (0.79%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 12 (3.17%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 24 11 9 10 27 2 11 8 0 4 5 4 0 14 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 11 9 0 7 9 5 2 5 9 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 1 4 7 13 0 1 1 3 11 3 1 6 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 0 2 10 8 4 0 2 5 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 97 118 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 106 76 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 142 136 86
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 30 (9.46%)
Serine (Ser, S)
n = 25 (7.89%)
Threonine (Thr, T)
n = 28 (8.83%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 7 (2.21%)
Leucine (Leu, L)
n = 57 (17.98%)
Isoleucine (Ile, I)
n = 22 (6.94%)
Methionine (Met, M)
n = 25 (7.89%)
Proline (Pro, P)
n = 20 (6.31%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 13 (4.1%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 10 23 9 6 26 1 14 7 0 1 1 5 0 9 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 4 13 13 0 2 6 3 1 3 9 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 0 3 5 14 0 1 2 9 4 0 1 6 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 2 1 7 0 0 2 5 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 79 98 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 100 57 129
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 87 160 66
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 16 (4.64%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 59 (17.1%)
Isoleucine (Ile, I)
n = 37 (10.72%)
Methionine (Met, M)
n = 35 (10.14%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 11 (3.19%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.51%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 14 28 6 10 36 0 6 10 0 0 1 5 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 4 7 5 0 1 2 8 1 3 9 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 22 1 2 12 12 1 0 4 7 4 0 1 10 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 2 10 1 0 3 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 90 149 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 106 62 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 97 164 73
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 16 (4.64%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 59 (17.1%)
Isoleucine (Ile, I)
n = 37 (10.72%)
Methionine (Met, M)
n = 35 (10.14%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 11 (3.19%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.51%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 14 28 6 10 36 0 6 10 0 0 1 5 0 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 4 7 5 0 1 2 8 1 3 9 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 22 1 2 12 12 1 0 4 7 4 0 1 10 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 2 10 1 0 3 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 90 149 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 106 62 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 97 164 73
ND4 (size: 1372 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.95%)
Alanine (Ala, A)
n = 27 (5.92%)
Serine (Ser, S)
n = 38 (8.33%)
Threonine (Thr, T)
n = 40 (8.77%)
Cysteine (Cys, C)
n = 5 (1.1%)
Valine (Val, V)
n = 8 (1.75%)
Leucine (Leu, L)
n = 91 (19.96%)
Isoleucine (Ile, I)
n = 39 (8.55%)
Methionine (Met, M)
n = 43 (9.43%)
Proline (Pro, P)
n = 27 (5.92%)
Phenylalanine (Phe, F)
n = 21 (4.61%)
Tyrosine (Tyr, Y)
n = 16 (3.51%)
Tryptophan (Trp, W)
n = 12 (2.63%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.82%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 12 (2.63%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 17 34 13 12 45 4 15 7 1 1 3 3 1 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 3 3 15 9 0 3 6 7 2 1 15 11 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 1 5 8 12 1 4 8 10 6 1 2 7 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 2 1 1 12 0 1 1 7 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 128 168 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 120 78 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 139 196 97
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 6 (6.12%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 26 (26.53%)
Isoleucine (Ile, I)
n = 8 (8.16%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 6 (6.12%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 4 7 1 2 12 2 8 2 0 0 1 2 3 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 2 3 0 0 3 1 0 2 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 2 2 2 0 0 0 4 2 0 1 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 24 27 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 19 19 53
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 26 44 21
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.49%)
Alanine (Ala, A)
n = 41 (6.82%)
Serine (Ser, S)
n = 57 (9.48%)
Threonine (Thr, T)
n = 59 (9.82%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 15 (2.5%)
Leucine (Leu, L)
n = 85 (14.14%)
Isoleucine (Ile, I)
n = 56 (9.32%)
Methionine (Met, M)
n = 42 (6.99%)
Proline (Pro, P)
n = 30 (4.99%)
Phenylalanine (Phe, F)
n = 45 (7.49%)
Tyrosine (Tyr, Y)
n = 17 (2.83%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 31 (5.16%)
Glutamine (Gln, Q)
n = 18 (3.0%)
Histidine (His, H)
n = 13 (2.16%)
Lysine (Lys, K)
n = 21 (3.49%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 25 35 11 18 39 5 12 17 1 3 1 10 1 17 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 10 14 17 0 5 7 11 4 4 14 12 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 24 1 8 12 23 1 2 11 7 10 1 0 8 23 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 1 2 8 21 0 1 5 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 143 222 134
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 174 121 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 209 245 126
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.56%)
Alanine (Ala, A)
n = 10 (5.65%)
Serine (Ser, S)
n = 15 (8.47%)
Threonine (Thr, T)
n = 9 (5.08%)
Cysteine (Cys, C)
n = 2 (1.13%)
Valine (Val, V)
n = 21 (11.86%)
Leucine (Leu, L)
n = 19 (10.73%)
Isoleucine (Ile, I)
n = 13 (7.34%)
Methionine (Met, M)
n = 14 (7.91%)
Proline (Pro, P)
n = 6 (3.39%)
Phenylalanine (Phe, F)
n = 9 (5.08%)
Tyrosine (Tyr, Y)
n = 10 (5.65%)
Tryptophan (Trp, W)
n = 4 (2.26%)
Aspartic acid (Asp, D)
n = 4 (2.26%)
Glutamic acid (Glu, E)
n = 8 (4.52%)
Asparagine (Asn, N)
n = 2 (1.13%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.13%)
Lysine (Lys, K)
n = 3 (1.69%)
Arginine (Arg, R)
n = 2 (1.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 0 4 2 0 0 1 9 0 0 9 2 3 7 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 2 0 4 0 2 4 13 1 4 6 5 0 0 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 3 4 0 2 2 7 0 10 0 1 7 2 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 7 3 1 1 2 1 0 0 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 13 48 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 33 30 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 4 31 91
Total protein-coding genes (size: 11386 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 205 (5.41%)
Alanine (Ala, A)
n = 250 (6.59%)
Serine (Ser, S)
n = 293 (7.73%)
Threonine (Thr, T)
n = 335 (8.83%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 143 (3.77%)
Leucine (Leu, L)
n = 599 (15.8%)
Isoleucine (Ile, I)
n = 342 (9.02%)
Methionine (Met, M)
n = 266 (7.01%)
Proline (Pro, P)
n = 204 (5.38%)
Phenylalanine (Phe, F)
n = 229 (6.04%)
Tyrosine (Tyr, Y)
n = 142 (3.74%)
Tryptophan (Trp, W)
n = 101 (2.66%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 89 (2.35%)
Asparagine (Asn, N)
n = 152 (4.01%)
Glutamine (Gln, Q)
n = 92 (2.43%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 97 (2.56%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
196 146 216 77 87 275 22 124 87 5 31 29 68 15 111 118
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
50 9 15 52 101 92 5 46 57 77 25 40 83 78 3 69
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
105 153 8 44 67 114 9 19 40 81 61 6 14 66 86 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
66 75 14 25 42 87 10 7 19 33 4 0 1 6 0 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
754 913 1252 874
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
453 1023 738 1579
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
191 1122 1580 900

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.