Viewing data for Cuora flavomarginata


Scientific name Cuora flavomarginata
Common name Yellow-margined box turtle
Maximum lifespan 19.10 years (Cuora flavomarginata@AnAge)

Total mtDNA (size: 16721 bases) GC AT G C A T
Base content (bases) 6409 10312 4268 2141 4627 5685
Base content per 1 kb (bases) 383 617 255 128 277 340
Base content (%) 38.3% 61.7%
Total protein-coding genes (size: 11355 bases) GC AT G C A T
Base content (bases) 4487 6868 3128 1359 3133 3735
Base content per 1 kb (bases) 395 605 275 120 276 329
Base content (%) 39.5% 60.5%
D-loop (size: 1207 bases) GC AT G C A T
Base content (bases) 305 902 189 116 493 409
Base content per 1 kb (bases) 253 747 157 96 408 339
Base content (%) 25.3% 74.7%
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 583 967 343 240 415 552
Base content per 1 kb (bases) 376 624 221 155 268 356
Base content (%) 37.6% 62.4%
Total rRNA-coding genes (size: 2562 bases) GC AT G C A T
Base content (bases) 1016 1546 589 427 570 976
Base content per 1 kb (bases) 397 603 230 167 222 381
Base content (%) 39.7% 60.3%
12S rRNA gene (size: 965 bases) GC AT G C A T
Base content (bases) 398 567 234 164 215 352
Base content per 1 kb (bases) 412 588 242 170 223 365
Base content (%) 41.2% 58.8%
16S rRNA gene (size: 1597 bases) GC AT G C A T
Base content (bases) 618 979 355 263 355 624
Base content per 1 kb (bases) 387 613 222 165 222 391
Base content (%) 38.7% 61.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 251 433 183 68 203 230
Base content per 1 kb (bases) 367 633 268 99 297 336
Base content (%) 36.7% 63.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 60 108 47 13 44 64
Base content per 1 kb (bases) 357 643 280 77 262 381
Base content (%) 35.7% 64.3%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 645 903 385 260 467 436
Base content per 1 kb (bases) 417 583 249 168 302 282
Base content (%) 41.7% 58.3%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 252 435 162 90 195 240
Base content per 1 kb (bases) 367 633 236 131 284 349
Base content (%) 36.7% 63.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 317 467 199 118 229 238
Base content per 1 kb (bases) 404 596 254 151 292 304
Base content (%) 40.4% 59.6%
CYTB (size: 1134 bases) GC AT G C A T
Base content (bases) 476 658 343 133 318 340
Base content per 1 kb (bases) 420 580 302 117 280 300
Base content (%) 42.0% 58.0%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 379 593 271 108 283 310
Base content per 1 kb (bases) 390 610 279 111 291 319
Base content (%) 39.0% 61.0%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 409 632 308 101 257 375
Base content per 1 kb (bases) 393 607 296 97 247 360
Base content (%) 39.3% 60.7%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 123 229 86 37 114 115
Base content per 1 kb (bases) 349 651 244 105 324 327
Base content (%) 34.9% 65.1%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 541 836 373 168 374 462
Base content per 1 kb (bases) 393 607 271 122 272 336
Base content (%) 39.3% 60.7%
ND4L (size: 300 bases) GC AT G C A T
Base content (bases) 127 173 90 37 88 85
Base content per 1 kb (bases) 423 577 300 123 293 283
Base content (%) 42.3% 57.7%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 704 1102 519 185 495 607
Base content per 1 kb (bases) 390 610 287 102 274 336
Base content (%) 39.0% 61.0%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 208 317 165 43 73 244
Base content per 1 kb (bases) 396 604 314 82 139 465
Base content (%) 39.6% 60.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 12 (5.29%)
Serine (Ser, S)
n = 10 (4.41%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 55 (24.23%)
Isoleucine (Ile, I)
n = 25 (11.01%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 11 8 7 20 2 17 9 0 2 0 4 2 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 6 2 0 2 0 7 1 2 0 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 0 4 0 4 0 0 2 0 3 0 1 5 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 2 1 0 3 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 68 82 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 61 35 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 54 113 50
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNLDPWFLILSSTWLVYTVILQPKISSYLSMNNPTNKDNKITNTNPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 6 (10.91%)
Phenylalanine (Phe, F)
n = 1 (1.82%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 2 (3.64%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 7 (12.73%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 1 0 1 3 1 2 2 0 0 0 2 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 1 2 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 1 3 1 0 0 0 2 0 0 0 3 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 1 1 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 13 23 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 18 17 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 16 24 12
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 45 (8.74%)
Serine (Ser, S)
n = 32 (6.21%)
Threonine (Thr, T)
n = 37 (7.18%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.8%)
Leucine (Leu, L)
n = 59 (11.46%)
Isoleucine (Ile, I)
n = 39 (7.57%)
Methionine (Met, M)
n = 33 (6.41%)
Proline (Pro, P)
n = 26 (5.05%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 19 (3.69%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.72%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 17 30 7 9 22 4 15 8 1 11 2 19 3 20 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 14 12 19 0 8 14 15 10 3 7 14 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 13 0 11 5 11 1 1 3 6 13 1 2 6 8 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 2 7 8 9 0 3 1 4 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 105 137 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 136 96 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 144 203 139
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 11 (4.82%)
Serine (Ser, S)
n = 16 (7.02%)
Threonine (Thr, T)
n = 15 (6.58%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 16 (7.02%)
Leucine (Leu, L)
n = 26 (11.4%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 18 (7.89%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 8 (3.51%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 9 (3.95%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 12 (5.26%)
Lysine (Lys, K)
n = 5 (2.19%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 8 17 5 1 8 1 10 7 0 3 2 8 3 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 3 3 5 0 1 0 4 3 1 1 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 4 2 7 0 0 3 6 3 0 1 3 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 1 2 6 5 0 0 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 54 68 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 53 64 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 55 108 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 8 10 2 5 7 1 16 7 1 2 2 10 1 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 5 8 8 0 4 6 9 1 4 1 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 1 3 0 8 0 1 3 5 7 0 1 1 4 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 0 3 2 2 0 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 56 61 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 75 123 56
CYTB (size: 1134 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.9%)
Alanine (Ala, A)
n = 25 (6.63%)
Serine (Ser, S)
n = 25 (6.63%)
Threonine (Thr, T)
n = 34 (9.02%)
Cysteine (Cys, C)
n = 3 (0.8%)
Valine (Val, V)
n = 12 (3.18%)
Leucine (Leu, L)
n = 62 (16.45%)
Isoleucine (Ile, I)
n = 30 (7.96%)
Methionine (Met, M)
n = 15 (3.98%)
Proline (Pro, P)
n = 23 (6.1%)
Phenylalanine (Phe, F)
n = 27 (7.16%)
Tyrosine (Tyr, Y)
n = 15 (3.98%)
Tryptophan (Trp, W)
n = 10 (2.65%)
Aspartic acid (Asp, D)
n = 9 (2.39%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 20 (5.31%)
Glutamine (Gln, Q)
n = 8 (2.12%)
Histidine (His, H)
n = 11 (2.92%)
Lysine (Lys, K)
n = 10 (2.65%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 21 13 11 11 23 2 15 6 2 0 3 9 0 6 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 5 15 5 0 5 7 12 2 3 7 12 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 11 0 4 5 15 0 0 1 2 13 0 0 10 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 3 6 10 0 1 1 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 97 110 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 106 78 146
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 140 152 77
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.95%)
Alanine (Ala, A)
n = 20 (6.19%)
Serine (Ser, S)
n = 27 (8.36%)
Threonine (Thr, T)
n = 23 (7.12%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.72%)
Leucine (Leu, L)
n = 56 (17.34%)
Isoleucine (Ile, I)
n = 25 (7.74%)
Methionine (Met, M)
n = 23 (7.12%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 22 (6.81%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.41%)
Asparagine (Asn, N)
n = 14 (4.33%)
Glutamine (Gln, Q)
n = 7 (2.17%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 19 8 8 24 0 15 6 1 1 1 10 0 10 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 8 6 0 3 4 8 1 4 3 15 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 0 3 9 14 0 0 1 3 9 0 1 4 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 1 3 8 0 0 1 5 1 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 81 94 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 93 60 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 97 156 59
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 29 (8.38%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 48 (13.87%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 28 (8.09%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 9 (2.6%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 16 (4.62%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 18 24 5 6 30 1 13 16 0 1 0 5 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 13 11 0 0 6 7 0 1 7 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 25 0 6 9 7 0 3 3 3 3 0 1 4 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 0 0 2 9 1 0 0 4 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 90 135 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 119 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 99 181 59
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.76%)
Alanine (Ala, A)
n = 29 (8.38%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 48 (13.87%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 28 (8.09%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 9 (2.6%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 16 (4.62%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 18 24 5 6 30 1 13 16 0 1 0 5 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 13 11 0 0 6 7 0 1 7 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 25 0 6 9 7 0 3 3 3 3 0 1 4 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 0 0 2 9 1 0 0 4 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 90 135 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 119 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 99 181 59
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (5.24%)
Alanine (Ala, A)
n = 34 (7.42%)
Serine (Ser, S)
n = 27 (5.9%)
Threonine (Thr, T)
n = 52 (11.35%)
Cysteine (Cys, C)
n = 7 (1.53%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 83 (18.12%)
Isoleucine (Ile, I)
n = 37 (8.08%)
Methionine (Met, M)
n = 38 (8.3%)
Proline (Pro, P)
n = 26 (5.68%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 15 (3.28%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 12 (2.62%)
Asparagine (Asn, N)
n = 14 (3.06%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 32 9 6 37 3 25 11 1 0 2 8 0 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 6 13 8 12 1 2 9 9 4 3 5 16 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 23 1 5 4 13 0 3 2 2 10 2 3 4 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 11 1 0 2 11 0 1 1 9 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 114 157 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 134 74 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 125 231 79
ND4L (size: 300 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.05%)
Alanine (Ala, A)
n = 9 (9.09%)
Serine (Ser, S)
n = 13 (13.13%)
Threonine (Thr, T)
n = 6 (6.06%)
Cysteine (Cys, C)
n = 4 (4.04%)
Valine (Val, V)
n = 2 (2.02%)
Leucine (Leu, L)
n = 22 (22.22%)
Isoleucine (Ile, I)
n = 5 (5.05%)
Methionine (Met, M)
n = 9 (9.09%)
Proline (Pro, P)
n = 2 (2.02%)
Phenylalanine (Phe, F)
n = 6 (6.06%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.01%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (3.03%)
Asparagine (Asn, N)
n = 2 (2.02%)
Glutamine (Gln, Q)
n = 4 (4.04%)
Histidine (His, H)
n = 5 (5.05%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.01%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 8 2 3 12 1 4 4 0 0 0 2 0 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 1 6 2 0 0 2 3 0 0 1 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 0 2 3 6 0 0 2 0 0 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 0 0 0 0 0 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 30 24 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 28 15 44
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 32 46 17
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.66%)
Alanine (Ala, A)
n = 37 (6.16%)
Serine (Ser, S)
n = 48 (7.99%)
Threonine (Thr, T)
n = 64 (10.65%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 16 (2.66%)
Leucine (Leu, L)
n = 93 (15.47%)
Isoleucine (Ile, I)
n = 66 (10.98%)
Methionine (Met, M)
n = 39 (6.49%)
Proline (Pro, P)
n = 30 (4.99%)
Phenylalanine (Phe, F)
n = 35 (5.82%)
Tyrosine (Tyr, Y)
n = 14 (2.33%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 9 (1.5%)
Glutamic acid (Glu, E)
n = 12 (2.0%)
Asparagine (Asn, N)
n = 31 (5.16%)
Glutamine (Gln, Q)
n = 16 (2.66%)
Histidine (His, H)
n = 14 (2.33%)
Lysine (Lys, K)
n = 23 (3.83%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 37 35 12 17 32 5 27 16 0 3 5 7 1 14 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 9 15 13 0 5 11 11 1 3 10 16 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 31 0 7 13 15 1 6 6 4 10 1 0 5 26 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 1 0 9 22 1 0 4 4 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 135 235 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 167 120 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 217 252 116
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.94%)
Alanine (Ala, A)
n = 11 (6.32%)
Serine (Ser, S)
n = 13 (7.47%)
Threonine (Thr, T)
n = 2 (1.15%)
Cysteine (Cys, C)
n = 5 (2.87%)
Valine (Val, V)
n = 23 (13.22%)
Leucine (Leu, L)
n = 28 (16.09%)
Isoleucine (Ile, I)
n = 8 (4.6%)
Methionine (Met, M)
n = 8 (4.6%)
Proline (Pro, P)
n = 4 (2.3%)
Phenylalanine (Phe, F)
n = 17 (9.77%)
Tyrosine (Tyr, Y)
n = 10 (5.75%)
Tryptophan (Trp, W)
n = 5 (2.87%)
Aspartic acid (Asp, D)
n = 3 (1.72%)
Glutamic acid (Glu, E)
n = 4 (2.3%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 2 (1.15%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 0 2 5 0 0 0 9 1 0 11 0 5 7 17 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 1 5 0 1 5 8 0 4 14 3 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 7 0 1 0 5 0 10 0 2 14 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 0 0 0 3 0 0 0 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 15 25 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 25 21 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 3 27 92
Total protein-coding genes (size: 11377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 227 (5.99%)
Alanine (Ala, A)
n = 260 (6.86%)
Serine (Ser, S)
n = 263 (6.94%)
Threonine (Thr, T)
n = 347 (9.15%)
Cysteine (Cys, C)
n = 34 (0.9%)
Valine (Val, V)
n = 158 (4.17%)
Leucine (Leu, L)
n = 604 (15.93%)
Isoleucine (Ile, I)
n = 319 (8.41%)
Methionine (Met, M)
n = 243 (6.41%)
Proline (Pro, P)
n = 212 (5.59%)
Phenylalanine (Phe, F)
n = 227 (5.99%)
Tyrosine (Tyr, Y)
n = 120 (3.17%)
Tryptophan (Trp, W)
n = 110 (2.9%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 140 (3.69%)
Glutamine (Gln, Q)
n = 101 (2.66%)
Histidine (His, H)
n = 103 (2.72%)
Lysine (Lys, K)
n = 87 (2.29%)
Arginine (Arg, R)
n = 69 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
155 164 206 77 75 232 22 174 95 6 34 17 90 17 103 124
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
37 13 21 71 96 87 6 39 61 89 38 29 45 127 11 79
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
117 148 3 57 54 105 2 19 26 46 74 6 24 46 94 43
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
60 80 13 23 40 85 2 8 13 45 3 0 2 7 3 104
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
801 891 1183 917
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
487 1037 717 1551
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
195 1081 1674 842

>NC_012054.1 Cuora flavomarginata mitochondrion, complete genome
GTTATTGTAGCTTATCGCAAAGCATGGCACTGAAGTTGCCAAGATGGGTCACCTACAAACCCCAAAAACA
CAAAGATTTGGTCCTAGCCTTACTGTTATTTTTTGTTAAATTTACACATGCAAGTATCAGCACACCAGTG
AAAATGCCCTAACAGTCCCATCAGACAAAAGGAGCAGGTATCAGGCACACCATGACAGCCCAAAACACCT
AGCTTTGCCACACCCCCAAGGGTATTTCAGCAGTGATAAAAATTAAGCAATAAGCATAAGCTTGACTTAG
TTATAGCAAACAGAGTTGGTCAATCTTGTGCCAGCCACCGCGGTTATACAAGAAACTCAAATTAACAGAA
AATCGGCGTAAAATGTGACTAAAATTATAATCTAAAAAATTAAGGTAACTCCCCACTCAACTGTCATACG
TAAAAGTACAAATCCCTCCAATATGAAAATAACCTTAATATAGTAGAATTATTTGAACCCACGATCGCTA
AGACACAAACTGGGATTAGATACCCCACTATGCTTAGCCCTAAACTTAGATATTTAACACACAAAAATAT
CCGCCAGAGAACTACGAGCAAAACGCTTAAAACTCTAAGGACTTGGCGGTACCTCAAATCCCCCTAGAGG
AGCCTGTTCTATAATCGATAATCCACGATCTACCTCACCATCTCTTGCCAATCCCGCCTATATACCACCG
TCACCAGCCTACCCCATGAAGGCCATAAAAGTAGGCAAAATAACTAAAACAGTTAACAAGTCAGGTCAAG
GTGCAGCTCACTGAGATGGAAGAAATGGGCTACATTTTCTGTACTAGAAATTAATTCACGGAAAGGAACT
ATGAAATAAGTCCCACAAGTTGGATTTAGTAGTAAGCTGGGATCAGAGTGCCCAACTTAAGTCGGTCCTG
AGGTGCGCACACACCGCCCGTCACCCTCCTCAAATAACTCAACAACATAAATAAACCCACAATAAACAAA
CAGATGAGGCAAGTCGTAACAAGGTAAGTACACCGGAAGGTGTACTTGGAACACCCAAAATATAGCTTAA
TTAAAAGCATTCAGCTTACACCTGAAAGATGTATATTAAAACAGGACTATTTTGAGCAAGAACCTAGCCC
AACCAAAATAAAAAACTTAACAAACAAAACTATCCCACCAAAACCAACCAAAACATTCTCACCATCCTAG
TATAGGCGATAGAAAAGACAGTTGGAGCAATAGAGATAGTACCGCAAGGGAAAGATGAAAAACAATGAAA
TATTCACTAAGCCATAAAAAGCAAAGATTAATCCTTATACCTTTTGCATCATGATTTAGCTAGCATATTC
AAGCAAAGAGCCCTAAAGTATGAAACCCCGAAACTAAGTGAGCTACTTAAAGGCAGCCACACCAAGGCTA
AATCCGTCTCTGTGGCAAAAGAGTGGAAAGACCTGTAAGTAGAGGTGAAAAGCCTAACGAACTTAGTGAT
AGCTGGTTGCTCAATAAAAGAATATAAGTTCAACCTTAAACCTTCTAAAAACAACCTAAAGTATAAAAGA
AAAGTTTAAGATTTATTCAATTGGGGTACAGCCCAATTGAAAAAGGATACAACCTAATAACGGAGGACAA
AACCCCAAAAATAACAACCGTAGGCCTTAAAGCAGCCACCAACTAAGAAAGCGTCAAAGCCCACCCGCTA
TTAAATAGTAACAAAAAATTTTTTCCCCTAATAATATTGAGCTACTCCATTTAAATAGAGGAATTAATGC
TAAAATGAGTAACAAGAAGACAAAACTTCTCTAATACGCTAGCTTAAGTCATAACAGATAAACTACTGAC
TATTAACATCCATCACTATAAAACAACAACATTTTAAATCACCCTATAGACCTAACTGTTAACCCAACAC
AGGAGCGTATACAAGAAAGATTAAAATTTGTAAAAGGAACTAGGCAAATAAACGAGCCCGACTGTTTACC
AAAAACATAGCCCCTAGCAACACAAGTATTAGGGGTAATGCCTGCCCAGTGACACTGTTAAACGGCCGCG
GTATCCTAACCGTGCAAAGGTAGCGTAATCACTTGTCTTTTAAATAAAGACTAGAATGAATGGCCAAACG
AGGTTCTACCTGTCTCTTACAAATAATCAGTGAAATTGATCTTCCTGTGCAAAAGCAGGAATAACATTAT
AAGACGAGAAGACCCTGTGGAACTTCAAATACAAATCAACTATTATCAACACCCACCTACGGGTCCACAT
CAAACTAGCATCTGACTTATATTTTCGGTTGGGGCGACCTCGGAGTAAAATAAAACCTCCGAAAAAGAAT
TTCCTTTTAAACCTAGACCTACAGCCCACAGTGCTTCCAGCAAAACGATCCAATATACTTGATCAACGAA
CCAAGCTACCCCAGGGATAACAGCGCAATCCCATCCTAGAGTTCCTATCGACGATGGAGTTTACGACCTC
GATGTTGGATCAGGACATCCTGATGGTGCAACTGCTATCAAGGGTTCGTTTGTTCAACGATTAACAGTCC
TACGTGATCTGAGTTCAGACCGGAGCAATCCAGGTCGGTTTCTATCTATAAGTTTAAGCCTTTTCTAGTA
CGAAAGGACCGAAAAGACAAGGCCCATACTAAAAACAAGCCTTACCTTACATTAGTGAAAACAACTTAAC
TAATAATAAGAAAAACAAACCACAGCCCTAAAAAAGGGCCTAATTGGGATGGCAGAGCCAGGTATAAATG
CAAAAGGCCTAAAGCCTTTATTCAGGGGTTCAATTCCCCTTTCCAATTATGAAAACACTACTAATCAACC
TAATATCCCCATTAATATACATAATTCCAATCCTCATCGCCGTAGCTTTCTTCACTCTACTTGAACGCAA
AGTACTCGGCTATATACAACTTCGAAAAGGCCCTAACACCGTAGGACCACAAGGATTACTTCAGCCAGTA
GCAGACGGTGTAAAATTATTTATTAAAGAACCAATCTACCCAGTAAATTCATCAATTACATTATTTGTTA
TTTCACCGATCATAGCTTTAACATTAGCCCTATCAATTTGACTCCCTCTCCCTATGCCCTTCCCACTAAC
TGACCTTAATTTAGGCCTTTTATTTCTAATCTCCATTTCCAGCTTTATAGCCTACTCCATCCTATGATCA
GGTTGAGCTTCAAACTCAAAATACGCCCTAATAGGAGCCTTACGGGCAGTAGCTCAAACCATCTCATACG
AAGTAACCCTAGGAATTATTCTACTCTCCATAATCCTTTTTTCAGGGGGATTTAATATACAAACATTTAT
AACAGTACAAGAACCTATATACTTAATATTTTCCTCCTGACCCTTAATAACAATATGATATATTTCTACA
CTAGCTGAAACTAACCGAGCACCATTCGATTTAACCGAAGGCGAATCTGAGCTTGTATCCGGATTCAACG
TCGAATACGCTGCCGGTCCATTCGCCCTATTCTTCCTAGCAGAATATTCTAACATCCTAATAATAAACAC
TCTAACTACCATTCTATTTCTAAATCCCGCCCACATCAACAACACCCCAGAATTATTCACCCTATCATTG
ATCTCAAAAACAATACTACTATCAGCAGGATTCCTATGAATTCGAACCTCCTACCCACGATTCCGATACG
ACCAACTCATGCACCTCCTATGAAAAAACTTCCTTCCAATCACCTTAGCACTATGCTTTTGACACATATC
AATGCCAATCACCTTATCAGGACTCCCGCCAATACCATAGGACACGTGCCTGAATTAAAGGACCACCTTG
ATAGGGTGAATAATAGAGGTTAAAATCCACTCGTCTCCTTAGAAAAATAGGAATTGAACCTACACCAGAG
AGATCAAAACTCCCCATACTTCCATTATACTATATCCTAGTAAAGTCAGCTAATTAAGCTCTTGGGCCCA
TACCCCAAAAATGTTGGTTAAAATCCCTCCTATACTAATGAACCCACATGCAACCACAATCATTATTACT
AGCCTAATCATAGGCCCACTACTCACAATCTCCAGTGACCATTGAATCCTAGCATGAATGGGCCTAGAAA
TCAGTACCTTAGCTATCACCCCATTAATCGCTAAACAACATCACCCCCGAGCAATCGAAGCAGCCACTAA
ATATTTCCTAACACAAGCAGCCGCCTCAACATTAATCCTAGCTTCTAGTATCACCAATGCATGACAAACA
GGCCAATGAGACCTTACCCAAATATCAAATGCACCTTCATCTGTAATTCTCACTACAGCCCTGGCCATCA
AACTAGGACTAGCTCCCTTCCATTTTTGATTGCCAGAAGTACTACAAGGAGCCACTACAATTACAGCTAT
AATCTTAACCACCTGACAAAAACTAGCACCATTATCCTTACTATTAATAACAGCCCAATCTATAAACACA
CCCTTAATGGTAACACTAGGACTAACATCCATTATTATTGGAGGATGAGGCGGCCTAAATCAAACCCAAC
TACGAAAAATTATGGCATTTTCCTCTATCGCCCACCTAGGATGAATAATCACAATTCTTACCTTATCCCC
AAAACTCATAATACTAACATTCTATACATACGCCATCATAACCTCCACAATATTCCTAATAATTGAACTC
TTAGAAACAAACAAAATCTCCGTAATAATAACATCATGAACAAAGCTACCAATACTAAACGCCACAATAA
TACTTATCCTTATATCACTAGCAGGCCTACCACCACTAACAGGATTTATACCCAAATGATTAATTATTCA
AGAACTATCTGAACAACACATATGCCTCACCGCCACTACAATAGCCGTTATATCAATACTAAGCTTATTC
TTTTACCTACGAACTTCATACCAAGCAACTATTACACTACCCCCAAACTGCACCAGCTCTACACAACAAT
GACGACACAAACCCAATCAAACATCCTATCTCACCCCAATAATTATACTATCCACCACCCTACTTCCAAT
CGTACCCACCCTATTAGCCATTATTTAGAAACTTAGGATCTGACCCACACTTAAACCAGGGGCCTTCAAA
GCCCCAAACAAGAGATAAAACCTCTTAGTTTCTGTTAAGACCTATAAGACTCTATCTTATATCTAATGAA
TGCAACTCAAACACTTTAATTAAGCTAAGGCCTTACTAGACAAATGGGCCTCGATCCCATAATAATTTAG
TTAACAGCTAAACACCCAATCCAGTGGGCTTCTGCCTATTTTTTCCCGCTCTCTAAAAAGCGGGAAAACC
CCGACACTAATAAAAGTGTATCTTCAAATTTGCAATTTGATGTGAATTTCACCACGGAATCTGATAAGAA
GAGGAATTAAACCTCTATAAAAAGGTCTACAGCCCAACGCTTAAACATTCAGCCATCTTACCTGTGTTTT
TAACCCGTTGATTTTTTTCTACAAACCATAAAGACATTGGCACCCTATATTTAATTTTCGGGGCCTGAGC
AGGTATAGCAGGCACAACATTAAGTTTGTTAATCCGCGCAGAACTAAGCCAACCAGGGGCTCTTCTGGGG
GACGACCAAATCTATAATGTCATCGTTACAGCCCATGCCTTTATTATAATCTTCTTCATGGTTATACCTG
TTATAATCGGCGGCTTTGGAAACTGACTCGTACCCTTAATAATTGGAGCACCAGATATAGCATTCCCGCG
TATAAACAATATAAGCTTCTGACTTCTCCCCCCATCTCTACTTCTACTCCTAGCCTCCTCAGGAATTGAA
GCAGGCGCAGGCACAGGCTGAACTGTATACCCACCCTTAGCTGGAAACCTGGCTCACGCTGGCGCCTCTG
TAGATCTAACTATTTTTTCCCTTCACCTGGCTGGTGTATCATCAATTCTAGGGGCTATTAACTTTATTAC
CACAGCAATTAACATAAAATCTCCAGCTATATCGCAATATCAGACACCTTTGTTTGTGTGATCTGTACTT
ATTACAGCCGTTCTATTACTGCTCTCACTACCAGTGCTCGCCGCAGGTATTACCATACTACTCACTGATC
GAAACCTAAATACAACCTTCTTTGACCCCTCAGGAGGAGGGGACCCAATTTTATACCAACATCTATTTTG
ATTCTTTGGTCACCCTGAAGTATACATCTTAATCTTACCAGGATTTGGCATAATCTCACATGTTGTTACC
TACTACGCCGGTAAAAAAGAACCATTCGGATATATAGGAATAGTTTGAGCAATAATATCTATCGGGTTTT
TAGGCTTTATTGTATGAGCCCACCACATATTTACCGTTGGCATAGATGTAGATACCCGAGCTTATTTTAC
TTCCGCAACAATAATTATTGCTATCCCAACAGGAGTAAAAGTATTCAGCTGATTAGCTACTCTACACGGA
GGGATAATTAAATGAGACGCTGCTATGTTATGAGCACTTGGCTTTATCTTCCTATTCACTATTGGGGGTC
TCACAGGTATTGTACTAGCCAATTCATCCCTAGATATCGTACTACATGACACCTACTACGTAGTAGCACA
CTTCCACTATGTTCTTTCTATGGGAGCTGTATTCGCTATAATAGCAGGATTCACCCATTGATTCCCGCTC
TTCACTGGGTACTCACTACACCAAACTTGAGCAAAAATTCACTTCGGAGTAATATTTGCAGGTGTTAACA
TCACCTTTTTCCCCCAACATTTTTTAGGCCTAGCCGGAATACCACGACGTTACTCTGACTACCCAGATGC
ATACACTCTATGGAATTCTATCTCATCAATCGGGTCTCTAATCTCCCTAATAGCAGTAATTATAATAATA
TTCATTATCTGAGAGGCATTCTCTTCAAAACGAAAAGTAATAATAGTCGAACTCACAACTACTAATGTAG
AATGATTACATGGCTGCCCACCCCCATACCACACCTACGAGGAACCCGCCCATGTTCAAACCCAAGAAAG
GAGGGAATCGAACCCCCTTAAACTAGTTTCAAGCCAGTCACATAACCCTTATGTTTCCTTCTTACAAGAC
GTTAGTAAAACACATTACTTAACTTTGTCAAGGTTAAATTATAGGTTTAAACCCTTTACGACTTAATGGC
ACACCCATTTCAATTAGGATTTCAAGACGCAATATCACCTATTATAGAAGAACTTCACCACTTTCATGAC
CACACTTTAATAATTGTATTCTTAATCAGCACCTTAGTACTTTATATTATTACATTAATAATAACAACTA
AACTAACATACACTAACACTATAAATGCTCAAGAAGTAGAAATAATTTGAACTGTCTTACCAGCTATCGT
TCTAATCACTATCGCACTACCATCTCTGCGAGTTCTTTATCTAATAGACGAAATCAACAACCCACATCTA
ACTATTAAAGCCATAGGACATCAATGATACTGAACATATGAGTATACCGACTACAAAAATCTTGAATTTG
ATTCCTATATAATTCCAACCCAAAGCCTTCCAAACGGACATTTCCGACTACTAGAAGTAGACCATCGCGT
GGTAATACCAATAGAATCCCCAATCCGAATATTAATCTCAGCCGAAGACGTCTTGCACTCATGAGCAATT
CCATCATTAGGTGTAAAAGCAGATGCCGTTCCAGGACGCTTAAATCAATCAACCTTCATTATAATACGCC
CAGGGGTATTCTATGGGCAATGTTCAGAAATCTGTGGGGCTAACCACAGCTTCATACCAATTGTGGTAGA
ATCTGTGCCCTTAAAACACTTCGAAAACTGATCTTCACTAATACTCTCTTAACCCACTAAAGAAGCTAAA
CAGGATAGCGCTAGCCTTTTAAGTTAGAAAAAGAGAACTCTCCGCCCTCCTTAGTGATATGCCGCAACTA
AACCTAGACCCGTGATTCCTAATTCTCTCCTCCACATGATTAGTATATACCGTAATCTTACAACCAAAAA
TCTCATCTTATCTGTCCATAAATAACCCTACCAATAAAGATAATAAAATTACTAACACAAACCCCTGAAC
CTGACCATGAACTTAACATTCTTCGATCAATTTATAAGCCCACAAATCATAGGAATTCCACTAATCATTT
TAGCCCTACTTATACCATCAATCATTTTCCCAATTCCAAACAACCGATGACTAACTAATCGCCTATCAAC
TCTACAAATATGAACAATCAATTTATTTACAAAACAACTAATATTACCTATTAACAAAACAGGTCACAAA
TGATCTATTATCCTAACATCACTAATAGCCATGCTTTTAGTAACCAATCTATTAGGATTATTACCATACA
CTTTTACCCCAACCACCCAACTCTCTATAAATATAGGACTGGCCATTCCAATATGACTCGCTACAGTACT
CACAGGACTTCGAAACCAACTAACAACATCACTAGGACATTTATTACCAGAGGGGACCCCAACCCTACTT
ATTCCAATCCTTATTATTATCGAAACAATCAGCCTCTTCATCCGACCTTTAGCCTTAGGTGTGCGACTCA
CAGCTAATCTAACAGCCGGACACTTATTAATCCAACTTACTTCTACCGCAGTACTAGCCCTATTGCCAAC
AATAATAACCTTATCTATCCTAACTGGAATCGTTCTCCTTTTACTAACCATCCTAGAGCTAGCAGTAGCT
ATGATTCAAGCTTACGTGTTTGTTTTACTTCTGTGTCTCTACCTACAAGAAAACATCTAATGGCCCACCA
AACACATGCCTATCACATAGTTGATCCAAGCCCATGACCATTGACAGGTGCAACAGCAGCATTACTCATA
ACTTCTGGTCTCGCCATATGATTCCACTACAATTCAATATTTTTAATAATCCTAGGCTTATCAATTATAT
TACTTACCATACTCCAGTGATGACGAGATATTGTGCGAGAAGGGACTTTTCAAGGACATCACACCCCTCC
TGTACAAAAAGGCTTACGATATGGCATAATCCTATTTATTACATCAGAAGTATTTTTCTTCATTGGATTC
TTCTGAGCTTTCTACCATTCAAGCCTGGCCCCTACGCCAGACTTAGGAGGATGTTGACCCCCAACAGGAA
TCACACCACTAAACCCATTCGAAGTACCTTTACTAAACACAGCAGTCTTATTAGCCTCAGGTGTAACAAT
CACCTGAGCCCACCACAGCCTAATAGAAGCTAACCGAAACCAAACCATCCAAGCCCTTAGTCTCACAATT
TTATTAGGATTATACTTCACAGCATTACAAGCTATAGAATACTATGAAGCACCATTCACAATCGCTGACG
GTGTATACGGCTCTACATTCTTTGTCGCAACAGGCTTCCATGGACTACATGTAATCATTGGATCAACATT
CTTAATTGTATGCTTACTACGACAAATTAAATACCATTTCACCTCTACCCACCACTTTGGATTTGAAGCA
GCCGCTTGATATTGACATTTTGTAGATGTTGTATGACTCTTCTTATACGTATCAATCTATTGATGAGGCT
CATGCTTTTCTAGTATAATAGTACAAGTGACTTCCAATCACTAAGTTTCAGTTTAACCCTAAAGAAAAGT
AATGAATCTAATAATTTCAATCACAATAATCTACCTAGCCCTACCCATAATTTTAACATTACTAAACTAC
TGATTTACCCTAACAAAACCAGATAACGAAAAATTATCCCCATATGAATGTGGCTTCGACCCACTAAAAA
CCACTCGCCCACCATTCTCAATTCGATTTTTTCTTAGTAGCAATTTTATTTCTTCTATTTGATTTAGAGA
TCGCACTACTACTACCTCTGCCATGAGCTATTCAACTACCATATCCAATTTACACTTTTACCTGAGCCTT
CATTATCATATCATTACTAACTCTAGGTCTCCTTTATGAATGAATTCAAGGGGGCCTAGAATGAGCAGAA
TAGATAACTAGTCTAACACAAGACAACTAATTTCGACTTAGTCAATCGTGATTAAATTTCACGGCTATCA
AATGATCACATCTATACATTTTACCTCCCTCTGCGCCTTTATTATTAGCACCCTGGGATTTTTATTACAC
CAAGCCCACCTAATTCCCACCCTACTTTGCCTCGAAGGAATAATACTATCCCTATTTATAGCCCTAGCAA
TATGATCTATTCAACTAGAGGCCTCATCATTCATACTTGCCCCGATACTAGTACTAACTTTCTCAGCTTG
CGAAGCCGGCATAGGATTATCACTACTCGTAGCATCCTCACGGACTCACGGCTCAAGCCACTTACAAAAC
CTAAACCTACTACAATGTTAAAAATAATGATTCCAATAATTTTATTACTACCAACAACCATACTATGTAA
ATCAAAACAACTCTGAACAGCTGCATTAACCCACAGTTTCTGAATCGCCCTTTTGAGCCTACAATGATTC
AAACCATCCACAGAATTGATAATCTTTTCTAACTGCTACCTAGGAGTAGACCCAATTTCCGCTCCCTTCC
TTATCCTATCATGCTGACTCACCCCAATAATAATTATAGCTGGCCAAAACAACCTAATTATAGAACCAAC
TCCACGAAAACGAACCTTTATCTTCACCACCATTTTACTGCAATTCTCATTAATTCTAGCTTTTTCAACT
ACAGAACTAATCATATTCTTCATCGCATTCGAATCTACATTACTCCCAACACTAGTAATTATTACACGAT
GGGGCGGCCAAATAGAACGACTAAACGCCGGAACCTACTTCCTATTTTACACTCTTATCGGGTCTCTGCC
ACTACTAGTAGCCCTCTTAGCTGCGCAAACCTACAGCGGCACCCTATCTATTTGCACATTACAACTATCT
ATCTACCCTAACATGACAAACCCATGAACTCACACAGTATGATGACTCGCACTATTCACTGCTTTCATGA
TCAAAATACCCCTATACGGGTTACACCTATGACTACCCAAAGCACACGTAGAGGCCCCGATCGCAGGGTC
AATAATCCTAGCAGCAGTACTTCTAAAACTAGGAGGATACGGCATTATCCGCATAACAATAACACTAGCC
CCGCCATTAAAAATATTCTCCTACCCATTCATAATATTGGCATTATGAGGAGTAATTATAACTGGCTTTA
TCTGCCTACGTCAAACGGACCTAAAATCATTAATTGCTTATTCATCCGTAGGCCATATAGGCTTAGTCAT
TGCTGCAGCATTAACACGAACCGAATGGGCATGCACTGGGGCTATCACACTTATAATCGCCCACGGTTTA
ACATCATCAATACTTTTCTGCCTAGCTAATACAAACTATGAACGAACTAACAGTCGAACACTACTTTTAG
CTCGAAACATACAGTTATTATTACCCCTAATAGGATTATGATGATTCTCAGCTAGTCTAACCAATATAGC
TCTTCCACCAACCATCAATCTAATAGGAGAACTAACCATTATCGTCTCACTATTTAATTGATCAAACACT
ACAATCCTAATAACAGGATTAGGTACCCTAATAGCCGCCACCTACACCCTATACATATTAATCATTACAC
AATGAGGAGAAACCCCTTCACACACAAAAACAATCCCTCCCACCCATACACGAGAACATCTACTCATGAT
ACTTCATATATTACCAATAGCACTGCTAATGATACAACCAGAATTAATTCAAGGCACCTAAACACCCTTC
ACCGTTAATATAGTTTCAAAACAAACATTAGACTGTGGCTCTAAAAATAGGAGTTAAAATCTCCTTATAA
ACCGAGAGAGGTATTATACAATAAGAACTGCTAACTCCTATATCTGAGACTAACCCCCTCAGCTCCCTCA
CTTTTAAAGGATAGAAGTAATCCACTGGTTTTAGGAACCACGAACCCTTGGTGCAATTCCAAGTAAAAGT
AATGACTTCACTTATAACAAACTCTACCCTTCTTCTAACATTACTCATACTAACACTACCCTTAATAATA
CCCATATACCCCCTCAAAGAGTGGTTAATTACAAAAACAAAAACAACTGTAAAAACAGCATTCTTCACCG
CCCTAATCCCATTAACCATCTTTATCCATCTAGACATTGAATCAATCATTACCAATTTCCACTGATTAAA
CATATTTACATTTAACATCAACATAAGTTTTAAATTCGACCAATACTCCATTATATTTGTACCTATTGCC
TTATACGTCACATGATCCATCCTGGAATTTTCCCACTGATATATATCTACAGACCCCCATATCACAAAAT
TCTTCAAGTACCTACTAATTTTCCTAGTAGTTATAATAATTCTAGTAACAGCCAACAACATACTCCAACT
CTTTGTCGGCTGAGAAGGAGTAGGAATTATATCTTTCTTACTAATTGGATGATGACGGGGACGCACAGAA
GCAAACTTATCGGCTCTACAAGCCATCCTTTACAACCGCACAGGAGACATTGGACTAATTCTTAGCATAT
CCTGATTAGCAATAAACATAAATACATGAGAACTCCAACAAATCTTTACCAGCACCAACCCAATCCCGCC
CCTCCCCCTCCTTGGCCTTATCTTAGCTGCAACAGGAAAATCAGCCCAATTCGGTCTTCACCCCTGACTG
CCAGCAGCTATAGAAGGCCCAACCCCAGTCTCAGCATTACTACACTCCAGTACAATAGTTGTCGCTGGCA
TCTTCCTACTCATCCGAGTCCACCCCATCATAACTACCAGTAATTTTGCCCTCTCAATCTGTTTATGCCT
GGGGGCTACCACTACCTTATTTACAGCATTCTGCGCTCTCACCCAAAATGACATCAAAAAAATCATTGCC
TTCTCTACATCAAGCCAACTTGGCCTTATAATAGTAACTATTGGTTTAAACCAACCACAACTAGCTTTCT
TACATATTTCCATGCACGCCTTCTTCAAAGCCATACTCTTCTTATGCTCCGGCTCTATCATTCACAACCT
CAGTGACGAACAAGACATTCGAAAAATAGGTGGACTGCACAAACCCCTACCAATTACCTCCTCATGCCTA
ACCATTGGTAGTATAGCTCTCACAGGTATACCATTCATAACTGGATTTTACTCCAAAGACATCATTATCG
AAGTTATAAACACATCCTACCTAAACGCCTGAGCCCTGCTCCTAACATTAATCGCAACCTCATTTACCGC
AATCTACAGCTTACGAATTATAACATTCGTGCAAACAGGACAACCCCGATACCCTTCCACAATACTACTA
AATGAAAACAACCCAACAATCATTAACCCAATCACTCGCCTTGCCGTAGGCAGCATTATCGCCGGACTCA
TCATCTCATTAAACACTATCCCACTAAAAACCCCACCAACAACTATACCAATGTACATTAAAATTGCAGC
ATTAACAATAACAATCCTAGGCTTACTATTAGCTCTAGAATTAACTGCAATGACCAACAAAATATCTACA
AAATCCCCTAACATCCACAACTTCTCTAACTCACTAGCCTATTTTAACACTCTAATTCACCGCTTATTCC
CAATAATTAACTTAAAATTCAGCCAAAACACTGCAACCCATCTAATCGACTTATCCTGATATGAAAACAT
TGGCCCAAAAGGCTTAGCCAAATCACAAATCACTCTAAGTACACTCATTTCATCACAAAAAGGCCTTATC
AAAATCTATATAACTTCATTTATCCTATCAATTATACTACTCATCATCCTAACCTAATCGCACGAAGCAC
TCCATGAGATAATCCACGAACCAACTCTAACACAACAAACAACGTCAACAACAATCCTCAACCAGCAACC
AAAAGCAACCCACTACCAAAACAATAAAGCCATGCAATCCCACTAAAATCTAAACGAACAGCATATAACC
CCCCAGCATCCACAGTATCAGCACCAATCCCTTCAATACTCCACAAATGACAACCCATTTGTACAAAAAC
TACAGCAATAAAAAGATAATACAATCCATAAAATACCCCCTCCAAACTTACTCAACCTACAGGAAAAGGC
TCCGCTATCAACGCAGATGAATACGCAAAAATAACCAACATCCCCCCTAAATAAATTAAAAACAACACTA
AAGAAACAAAAGACCCCCCTATACCAACCAACACCCCGCACCCAGAAAGCGCACCAAAAATTAAACTAAC
CACCCCATAATAAGGAGAGGGGTTACAAGAAACACCCACCATTCAAAAAACAAAACAAAACCCAAATAAA
AACATAAAATACATCATAATTCTTGCCTGGATTCCGACCAAGACCTGCAATTTGAAAAACTACCGTTGTA
TTCAACTACAAAAACATTAATGACCACAAACCTGCGAAAAACCCATCCTATAATAAAAATTATCAACAAC
TCATTTATCGATCTCCCAAGCCCTTCTAATATCTCTGCTTTATGAAATTTCGGATCACTATTAGGCGCCT
GCCTTATCCTACAGATCATCACCGGAATCTTCCTGGCAATACACTACTCACCAGACATCTCACTAGCCTT
CTCATCAGTAGCCCATATCACCCGAGACGTACAGTACGGATGATTAATCCGCAATATACATGCCAACGGG
GCCTCTATATTCTTTATATGCATCTACCTTCATATTGGTCGAGGACTTTACTATGGCTCATATCTTTACA
AAGAAACCTGAAACACAGGAATCGCCCTACTATTCCTAACCATAGCTACTGCATTCGTAGGCTACGTCTT
ACCATGAGGCCAAATATCATTCTGAGGTGCCACCGTCATCACTAACCTACTCTCAGCCACCCCCTACATT
GGCAATACTCTTGTACAATGAATTTGAGGGGGATTCTCAGTAGACAATGCCACCTTAACTCGATTCTTCA
CCTTTCATTTTCTACTCCCCTTCGCCATCGCCGGTTTAGCAGCTGTACATTTACTCTTCCTCCACGAAAC
TGGATCAAACAATCCAACAGGATTAAATTCAAACACTGACAAAATCCCCTTCCACCCCTACTTCTCATAC
AAAGACCTACTAGGTCTCATTTTAATACTCGCCCTATTACTAACTCTAGCATTATTTTCCCCGAATCTTC
TAGGCGACCCAGATAATTTCACACCTGCTAACCCACTATCCACTCCCCCCCACATCAAACCAGAATGATA
CTTCCTCTTCGCCTACGCAATCCTTCGATCCATCCCAAACAAACTAGGAGGTGTACTTGCCCTTCTATCC
TCTATCCTTGTATTATTTATAATACCAACTCTACACACCTCAAAACAACGTACAACTTCATTCCGACCAT
TAACCCAAATTCTCTTCTGATGTTTAACAGCTGATCTACTAGTACTCACATGAATTGGAGGACAACCAGT
CGAAAATCCATTCATTACTATCGGCCAAACAGCCTCCATCCTATACTTCATAATTCTATTAACACTTATA
CCCCTCACAGGACTAATGAAAACAAAATACTAAACCAAAAATACTCTAGTAGCTTAATCTATAAAGCATT
GGTCTTGTAAACCAAAGACTGAAGAGTACAATCTTCCCAGAGTGATCAAAAAAGAAGGATCTAAGCCTTC
ATCCCCGGCCCCCAAAACCGGAATTTTTATTAAACTACCTTTTGGCTAACGCCAAAACCTAACCATTTTT
CTCTCCCGTGCCCAACAGAGAAATGTCTACTATACCTTACTATGTATATCGTGCATTCATTTTTTTTCCC
CTAGCATATCACTAGTAATATTACTGCTTGATCTCATTAGGACTTAACAAATATAATTAATACTTACTAT
TCTGTTTAAAACATGAATATTATTTAGGTATTATTAAGTTAATGATTTAAGGACATAAACTTATATAATT
GTTTTACACCATGGATATGGCTCAGTATTTGTTTATCTCTTAATTCAGCTGATCACGAGAAATAAGCAAC
CCTTGTTAGTAAGATACAACATTACCAGTTTCAAGCCCATGTAATGATGGCGTACATAACTGATCTATTC
TGGCCTCTGGTTGTTTTTTCAGGCACATAATACTAATAAAGTTCATTCGTTTCTCTTTAAAAGGCCTCTG
GTTAATGTGTTCTATACATTAGATTTATAACCTGACATATGGTGTTCTTAAATGCATATAGTAGTCTTTT
TTTTCTCTTTCTGTTCTCAGGCCCGCATAACTGATACCTGCCTACTCAGTGAAACTGGACTTACGTTCAA
GTTGATTGGTCTTGCAAGTTTGATATGGTATTATTAAGTTAATGCTTGTAGGACATATATTTTTACAAAA
ACCCACGACAGTAATTTCAAGCCATTCGTTAAAATAGATATATTTTATTTTAGCTAAACCCCCCTACCCC
CCGTCAAACTAACACTCAGCCCGAATAGCCACTTAATTCTCGTCAAACCCCTAAATCCGAGAGCAACTAA
ACTGACACAAATGCTAGCCATAGGTACTATTACAAAACAAGTGTACCTACCAAACTAAACAACTCTAATA
AAACCACCATATCCACCCATATATTATATTATTATATTATTATATTATTATATTATTATATTATTATATT
ATTATATTATTATATTATTATATTATTATATTATTATATTATTATATTATTATATTATTATATTATTATA
TTATTATATTATTATATTATTATATTATTATATTATATTATATTATTATATTATATTATATTATATTATA
TTATATTATATTATATTATATTATATTATATTATATTATATTATATTATATTATATTATATTATATTATA
TTATATTATATTATATTATATTATATTATATTATATATATATATATATATATATATATATA


Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.