Viewing data for Acrocephalus scirpaceus


Scientific name Acrocephalus scirpaceus
Common name Eurasian reed-warbler
Maximum lifespan 14.00 years (Acrocephalus scirpaceus@AnAge)

Total mtDNA (size: 17903 bases) GC AT G C A T
Base content (bases) 8576 9327 5771 2805 4087 5240
Base content per 1 kb (bases) 479 521 322 157 228 293
Base content (%) 47.9% 52.1%
Total protein-coding genes (size: 11382 bases) GC AT G C A T
Base content (bases) 5544 5838 3893 1651 2569 3269
Base content per 1 kb (bases) 487 513 342 145 226 287
Base content (%) 48.7% 51.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1542 bases) GC AT G C A T
Base content (bases) 667 875 392 275 374 501
Base content per 1 kb (bases) 433 567 254 178 243 325
Base content (%) 43.3% 56.7%
Total rRNA-coding genes (size: 2580 bases) GC AT G C A T
Base content (bases) 1205 1375 674 531 523 852
Base content per 1 kb (bases) 467 533 261 206 203 330
Base content (%) 46.7% 53.3%
12S rRNA gene (size: 977 bases) GC AT G C A T
Base content (bases) 480 497 267 213 196 301
Base content per 1 kb (bases) 491 509 273 218 201 308
Base content (%) 49.1% 50.9%
16S rRNA gene (size: 1603 bases) GC AT G C A T
Base content (bases) 725 878 407 318 327 551
Base content per 1 kb (bases) 452 548 254 198 204 344
Base content (%) 45.2% 54.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 325 359 244 81 160 199
Base content per 1 kb (bases) 475 525 357 118 234 291
Base content (%) 47.5% 52.5%
ATP8 (size: 171 bases) GC AT G C A T
Base content (bases) 70 101 60 10 40 61
Base content per 1 kb (bases) 409 591 351 58 234 357
Base content (%) 40.9% 59.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 770 781 483 287 363 418
Base content per 1 kb (bases) 496 504 311 185 234 270
Base content (%) 49.6% 50.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 335 349 225 110 146 203
Base content per 1 kb (bases) 490 510 329 161 213 297
Base content (%) 49.0% 51.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 405 379 266 139 187 192
Base content per 1 kb (bases) 517 483 339 177 239 245
Base content (%) 51.7% 48.3%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 556 587 392 164 277 310
Base content per 1 kb (bases) 486 514 343 143 242 271
Base content (%) 48.6% 51.4%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 488 490 324 164 239 251
Base content per 1 kb (bases) 499 501 331 168 244 257
Base content (%) 49.9% 50.1%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 494 547 361 133 235 312
Base content per 1 kb (bases) 475 525 347 128 226 300
Base content (%) 47.5% 52.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 167 184 116 51 82 102
Base content per 1 kb (bases) 476 524 330 145 234 291
Base content (%) 47.6% 52.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 658 720 483 175 312 408
Base content per 1 kb (bases) 478 522 351 127 226 296
Base content (%) 47.8% 52.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 156 141 117 39 62 79
Base content per 1 kb (bases) 525 475 394 131 209 266
Base content (%) 52.5% 47.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 866 952 626 240 412 540
Base content per 1 kb (bases) 476 524 344 132 227 297
Base content (%) 47.6% 52.4%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 259 260 199 60 58 202
Base content per 1 kb (bases) 499 501 383 116 112 389
Base content (%) 49.9% 50.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 60 (26.43%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 15 6 3 12 27 10 7 8 0 1 3 3 2 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 8 4 1 0 3 3 2 0 8 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 2 0 6 5 0 0 4 0 3 1 1 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 2 4 0 0 3 1 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 84 69 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 95 95 16
ATP8 (size: 171 bases)
Amino acid sequence: MPQLNPNPWFFIMLTSWLTFSMIIQPKLLTFVSMNPPSNKMSTTTPDTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (8.93%)
Threonine (Thr, T)
n = 10 (17.86%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.79%)
Leucine (Leu, L)
n = 5 (8.93%)
Isoleucine (Ile, I)
n = 3 (5.36%)
Methionine (Met, M)
n = 5 (8.93%)
Proline (Pro, P)
n = 9 (16.07%)
Phenylalanine (Phe, F)
n = 4 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (8.93%)
Aspartic acid (Asp, D)
n = 1 (1.79%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.14%)
Glutamine (Gln, Q)
n = 2 (3.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.57%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 3 0 2 2 0 0 2 0 0 0 1 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 0 5 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 0 2 3 0 0 0 0 0 0 1 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 1 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 15 24 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 24 10 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 21 27 6
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 51 (9.88%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 35 (6.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.17%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 26 (5.04%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 32 14 2 13 33 10 3 8 1 2 8 19 8 10 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 7 25 15 4 2 16 23 6 5 8 16 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 15 0 2 9 12 0 0 4 3 14 2 1 2 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 7 3 1 14 9 0 1 0 7 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 124 128 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 139 94 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 220 196 52
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 4 2 9 13 4 1 5 2 2 7 4 2 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 3 11 5 0 0 3 4 1 2 2 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 0 0 6 8 0 1 2 0 7 0 2 1 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 2 0 12 3 1 1 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 61 59 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 63 60 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 101 84 24
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 27 (10.38%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 8 5 1 7 16 3 4 5 2 3 7 5 2 1 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 4 15 5 3 0 8 7 4 1 5 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 4 0 3 5 4 0 0 4 2 9 0 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 4 4 2 2 4 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 69 53 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 71 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 126 84 28
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 23 (6.05%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 21 (5.53%)
Leucine (Leu, L)
n = 65 (17.11%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 30 (7.89%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 19 (5.0%)
Glutamine (Gln, Q)
n = 7 (1.84%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 25 4 5 17 32 9 1 6 1 2 7 12 0 9 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 1 17 11 0 1 7 11 5 1 10 10 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 9 1 2 10 11 0 0 2 2 10 0 1 3 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 0 9 9 1 1 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 114 94 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 99 77 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 179 139 38
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 32 (9.85%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 19 (5.85%)
Leucine (Leu, L)
n = 64 (19.69%)
Isoleucine (Ile, I)
n = 20 (6.15%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 21 (6.46%)
Tyrosine (Tyr, Y)
n = 13 (4.0%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 16 4 5 9 34 9 5 5 1 1 8 6 4 7 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 3 16 11 2 1 5 5 3 1 12 10 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 3 0 9 9 1 2 5 3 10 3 2 2 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 4 0 4 4 3 2 1 5 0 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 99 76 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 93 57 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 132 118 33
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 32 (9.25%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 42 (12.14%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 27 (7.8%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 10 (2.89%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 20 11 6 12 31 9 4 7 3 1 4 7 1 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 6 11 12 3 0 6 4 2 1 8 10 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 17 1 3 13 7 1 0 8 0 7 2 0 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 1 3 0 2 13 1 0 1 2 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 101 119 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 118 58 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 142 135 36
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 32 (9.25%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 42 (12.14%)
Cysteine (Cys, C)
n = 3 (0.87%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 27 (7.8%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 10 (2.89%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 10 (2.89%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 20 11 6 12 31 9 4 7 3 1 4 7 1 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 6 11 12 3 0 6 4 2 1 8 10 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 17 1 3 13 7 1 0 8 0 7 2 0 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 1 3 0 2 13 1 0 1 2 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 101 119 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 118 58 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 142 135 36
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 39 (8.52%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 42 (9.17%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 45 (9.83%)
Methionine (Met, M)
n = 28 (6.11%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 14 (3.06%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 34 21 3 18 48 19 6 10 2 1 6 2 2 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 3 19 16 1 2 6 5 5 3 12 11 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 15 1 4 12 12 0 0 8 3 11 1 0 0 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 1 1 1 9 1 1 3 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 156 147 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 137 78 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 190 183 44
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 5 0 5 13 1 1 3 0 0 1 1 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 0 6 4 0 0 2 1 1 0 2 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 1 5 2 1 0 3 0 2 0 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 0 0 1 0 0 0 1 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 34 23 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 32 17 36
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 51 39 3
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.96%)
Alanine (Ala, A)
n = 52 (8.6%)
Serine (Ser, S)
n = 48 (7.93%)
Threonine (Thr, T)
n = 65 (10.74%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 21 (3.47%)
Leucine (Leu, L)
n = 105 (17.36%)
Isoleucine (Ile, I)
n = 50 (8.26%)
Methionine (Met, M)
n = 28 (4.63%)
Proline (Pro, P)
n = 33 (5.45%)
Phenylalanine (Phe, F)
n = 34 (5.62%)
Tyrosine (Tyr, Y)
n = 14 (2.31%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 25 (4.13%)
Glutamine (Gln, Q)
n = 18 (2.98%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 32 22 4 32 45 15 7 16 2 1 7 7 6 5 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 5 9 25 18 0 0 14 15 1 3 11 19 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 20 5 5 17 11 4 1 10 3 11 2 2 3 22 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 12 0 1 9 17 4 1 1 6 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
125 168 201 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 187 113 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 271 226 62
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (17.44%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 12 (6.98%)
Threonine (Thr, T)
n = 5 (2.91%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 32 (18.6%)
Leucine (Leu, L)
n = 27 (15.7%)
Isoleucine (Ile, I)
n = 4 (2.33%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 11 (6.4%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 5 (2.91%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 1 0 1 5 4 0 0 13 2 3 14 9 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 4 1 3 4 7 4 2 17 3 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 2 6 1 1 3 0 1 7 0 2 16 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 5 0 0 1 0 0 1 3 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 15 20 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 32 19 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
76 13 19 65
Total protein-coding genes (size: 11399 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.77%)
Alanine (Ala, A)
n = 327 (8.61%)
Serine (Ser, S)
n = 277 (7.29%)
Threonine (Thr, T)
n = 320 (8.43%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 202 (5.32%)
Leucine (Leu, L)
n = 653 (17.19%)
Isoleucine (Ile, I)
n = 280 (7.37%)
Methionine (Met, M)
n = 165 (4.34%)
Proline (Pro, P)
n = 225 (5.92%)
Phenylalanine (Phe, F)
n = 227 (5.98%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 70 (1.84%)
Glutamic acid (Glu, E)
n = 88 (2.32%)
Asparagine (Asn, N)
n = 129 (3.4%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 108 (2.84%)
Lysine (Lys, K)
n = 87 (2.29%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
73 207 104 32 142 308 98 45 79 14 27 62 71 42 54 173
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
61 4 27 42 160 107 18 13 75 84 47 21 86 107 11 43
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
142 120 15 26 96 88 10 4 53 24 85 14 28 19 110 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
96 68 20 11 59 74 13 8 15 43 5 2 1 7 1 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
906 1077 1041 775
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
488 1092 692 1527
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
398 1588 1400 413

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.