Viewing data for Trachemys scripta


Scientific name Trachemys scripta
Common name Common slider
Maximum lifespan 41.30 years (Trachemys scripta@AnAge)

Total mtDNA (size: 16810 bases) GC AT G C A T
Base content (bases) 6511 10299 4350 2161 4537 5762
Base content per 1 kb (bases) 387 613 259 129 270 343
Base content (%) 38.7% 61.3%
Total protein-coding genes (size: 11381 bases) GC AT G C A T
Base content (bases) 4455 6926 3135 1320 3118 3808
Base content per 1 kb (bases) 391 609 275 116 274 335
Base content (%) 39.1% 60.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1552 bases) GC AT G C A T
Base content (bases) 591 961 349 242 420 541
Base content per 1 kb (bases) 381 619 225 156 271 349
Base content (%) 38.1% 61.9%
Total rRNA-coding genes (size: 2589 bases) GC AT G C A T
Base content (bases) 1026 1563 593 433 566 997
Base content per 1 kb (bases) 396 604 229 167 219 385
Base content (%) 39.6% 60.4%
12S rRNA gene (size: 969 bases) GC AT G C A T
Base content (bases) 405 564 236 169 207 357
Base content per 1 kb (bases) 418 582 244 174 214 368
Base content (%) 41.8% 58.2%
16S rRNA gene (size: 1620 bases) GC AT G C A T
Base content (bases) 621 999 357 264 359 640
Base content per 1 kb (bases) 383 617 220 163 222 395
Base content (%) 38.3% 61.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 261 423 191 70 196 227
Base content per 1 kb (bases) 382 618 279 102 287 332
Base content (%) 38.2% 61.8%
ATP8 (size: 189 bases) GC AT G C A T
Base content (bases) 62 127 50 12 54 73
Base content per 1 kb (bases) 328 672 265 63 286 386
Base content (%) 32.8% 67.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 637 908 376 261 461 447
Base content per 1 kb (bases) 412 588 243 169 298 289
Base content (%) 41.2% 58.8%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 256 431 168 88 191 240
Base content per 1 kb (bases) 373 627 245 128 278 349
Base content (%) 37.3% 62.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 331 453 216 115 214 239
Base content per 1 kb (bases) 422 578 276 147 273 305
Base content (%) 42.2% 57.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 464 676 335 129 321 355
Base content per 1 kb (bases) 407 593 294 113 282 311
Base content (%) 40.7% 59.3%
ND1 (size: 971 bases) GC AT G C A T
Base content (bases) 381 590 274 107 282 308
Base content per 1 kb (bases) 392 608 282 110 290 317
Base content (%) 39.2% 60.8%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 384 655 299 85 266 389
Base content per 1 kb (bases) 370 630 288 82 256 374
Base content (%) 37.0% 63.0%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 138 212 96 42 100 112
Base content per 1 kb (bases) 394 606 274 120 286 320
Base content (%) 39.4% 60.6%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 529 852 390 139 366 486
Base content per 1 kb (bases) 383 617 282 101 265 352
Base content (%) 38.3% 61.7%
ND4L (size: 298 bases) GC AT G C A T
Base content (bases) 120 178 87 33 90 88
Base content per 1 kb (bases) 403 597 292 111 302 295
Base content (%) 40.3% 59.7%
ND5 (size: 1827 bases) GC AT G C A T
Base content (bases) 696 1131 495 201 513 618
Base content per 1 kb (bases) 381 619 271 110 281 338
Base content (%) 38.1% 61.9%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 207 318 165 42 77 241
Base content per 1 kb (bases) 394 606 314 80 147 459
Base content (%) 39.4% 60.6%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 12 (5.29%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 28 (12.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 12 14 7 7 16 4 14 10 0 0 1 4 2 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 7 3 0 1 4 4 0 1 1 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 3 3 5 0 0 3 2 1 0 5 6 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 1 0 3 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
33 66 82 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 36 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 60 109 43
ATP8 (size: 189 bases)
Amino acid sequence: MPQLNPDPWFLILSSSWLTYIIILQPKISSYLSTNNPTNKDNKTMHTDPWTWPWIQHSSINS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 9 (14.52%)
Threonine (Thr, T)
n = 6 (9.68%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (9.68%)
Isoleucine (Ile, I)
n = 7 (11.29%)
Methionine (Met, M)
n = 2 (3.23%)
Proline (Pro, P)
n = 7 (11.29%)
Phenylalanine (Phe, F)
n = 1 (1.61%)
Tyrosine (Tyr, Y)
n = 2 (3.23%)
Tryptophan (Trp, W)
n = 5 (8.06%)
Aspartic acid (Asp, D)
n = 3 (4.84%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 6 (9.68%)
Glutamine (Gln, Q)
n = 3 (4.84%)
Histidine (His, H)
n = 2 (3.23%)
Lysine (Lys, K)
n = 3 (4.84%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 2 1 0 1 1 0 4 3 0 0 0 0 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 0 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 1 1 3 4 1 0 0 0 2 1 0 4 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 3 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 14 24 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 20 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 14 29 16
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 43 (8.37%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 37 (7.2%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 31 (6.03%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 38 (7.39%)
Tyrosine (Tyr, Y)
n = 20 (3.89%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 15 (2.92%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 20 (3.89%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 28 8 4 20 3 24 7 0 5 7 21 5 19 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 11 14 16 2 2 16 19 10 6 6 16 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 16 0 7 7 13 1 2 2 10 10 2 1 7 8 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 3 3 12 9 1 2 2 4 0 1 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 98 136 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 136 96 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 142 215 127
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 10 (4.39%)
Serine (Ser, S)
n = 14 (6.14%)
Threonine (Thr, T)
n = 17 (7.46%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.58%)
Leucine (Leu, L)
n = 27 (11.84%)
Isoleucine (Ile, I)
n = 19 (8.33%)
Methionine (Met, M)
n = 18 (7.89%)
Proline (Pro, P)
n = 15 (6.58%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 10 (4.39%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 9 (3.95%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 6 17 1 6 8 1 11 7 0 1 4 8 2 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 3 3 2 1 0 7 0 3 3 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 7 0 1 5 6 0 1 1 6 4 0 0 2 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 1 5 4 4 0 1 0 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 54 68 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 54 63 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 60 109 51
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 9 11 4 2 16 1 9 7 1 0 3 10 2 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 8 8 0 3 7 8 1 2 2 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 0 2 1 7 1 1 3 4 7 0 1 1 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 0 4 0 2 0 0 0 4 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 64 64 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 53 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 84 122 46
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 33 (8.71%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 13 (3.43%)
Leucine (Leu, L)
n = 64 (16.89%)
Isoleucine (Ile, I)
n = 36 (9.5%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 22 (5.8%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 18 12 10 10 27 2 14 9 0 2 1 10 0 6 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 4 10 7 0 4 9 13 0 3 4 15 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 12 0 5 6 11 1 0 1 4 10 0 1 3 19 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 3 5 8 1 1 0 7 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 100 114 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 100 79 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 135 162 76
ND1 (size: 971 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 21 (6.52%)
Serine (Ser, S)
n = 30 (9.32%)
Threonine (Thr, T)
n = 17 (5.28%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.73%)
Leucine (Leu, L)
n = 63 (19.57%)
Isoleucine (Ile, I)
n = 20 (6.21%)
Methionine (Met, M)
n = 24 (7.45%)
Proline (Pro, P)
n = 25 (7.76%)
Phenylalanine (Phe, F)
n = 21 (6.52%)
Tyrosine (Tyr, Y)
n = 14 (4.35%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 13 (4.04%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 24 5 9 32 3 14 4 2 3 0 9 0 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 6 8 7 0 3 3 10 0 4 4 16 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 6 0 7 9 12 0 0 2 7 7 1 0 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 1 3 8 0 0 0 6 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 89 84 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 91 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 94 165 55
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 24 (6.96%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 54 (15.65%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 62 (17.97%)
Isoleucine (Ile, I)
n = 28 (8.12%)
Methionine (Met, M)
n = 27 (7.83%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 10 (2.9%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 14 27 7 3 36 1 15 12 1 0 1 4 0 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 8 8 7 1 2 2 7 1 1 4 14 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 24 0 4 8 10 0 2 4 3 7 0 0 4 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 0 13 0 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 90 140 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 119 61 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 90 188 64
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 24 (6.96%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 54 (15.65%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 62 (17.97%)
Isoleucine (Ile, I)
n = 28 (8.12%)
Methionine (Met, M)
n = 27 (7.83%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 10 (2.9%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 14 27 7 3 36 1 15 12 1 0 1 4 0 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 8 8 7 1 2 2 7 1 1 4 14 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 24 0 4 8 10 0 2 4 3 7 0 0 4 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 0 13 0 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 90 140 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 119 61 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 90 188 64
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.58%)
Alanine (Ala, A)
n = 30 (6.54%)
Serine (Ser, S)
n = 34 (7.41%)
Threonine (Thr, T)
n = 55 (11.98%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 9 (1.96%)
Leucine (Leu, L)
n = 82 (17.86%)
Isoleucine (Ile, I)
n = 46 (10.02%)
Methionine (Met, M)
n = 29 (6.32%)
Proline (Pro, P)
n = 25 (5.45%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 15 (3.27%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 16 (3.49%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 12 (2.61%)
Arginine (Arg, R)
n = 9 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 22 28 9 17 41 0 15 15 1 1 0 7 1 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 5 10 10 10 0 6 1 11 3 2 3 20 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 32 0 2 7 17 0 2 6 6 9 2 0 2 14 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 0 1 1 11 1 0 1 8 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 128 166 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 136 82 184
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 126 238 87
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 5 (5.1%)
Serine (Ser, S)
n = 16 (16.33%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 5 (5.1%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 5 3 3 9 0 6 3 2 0 1 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 1 2 2 0 0 3 1 0 2 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 1 1 10 1 2 1 1 2 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
14 29 25 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 28 18 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 30 44 19
ND5 (size: 1827 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.1%)
Alanine (Ala, A)
n = 46 (7.57%)
Serine (Ser, S)
n = 43 (7.07%)
Threonine (Thr, T)
n = 54 (8.88%)
Cysteine (Cys, C)
n = 10 (1.64%)
Valine (Val, V)
n = 19 (3.13%)
Leucine (Leu, L)
n = 94 (15.46%)
Isoleucine (Ile, I)
n = 56 (9.21%)
Methionine (Met, M)
n = 45 (7.4%)
Proline (Pro, P)
n = 27 (4.44%)
Phenylalanine (Phe, F)
n = 35 (5.76%)
Tyrosine (Tyr, Y)
n = 20 (3.29%)
Tryptophan (Trp, W)
n = 11 (1.81%)
Aspartic acid (Asp, D)
n = 12 (1.97%)
Glutamic acid (Glu, E)
n = 9 (1.48%)
Asparagine (Asn, N)
n = 25 (4.11%)
Glutamine (Gln, Q)
n = 16 (2.63%)
Histidine (His, H)
n = 14 (2.3%)
Lysine (Lys, K)
n = 31 (5.1%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 25 39 10 17 39 1 25 15 1 1 8 9 1 15 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 6 7 21 18 0 2 15 12 2 2 7 18 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 28 0 9 11 17 0 1 5 7 13 2 2 10 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 6 6 30 1 0 6 4 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
117 134 217 141
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 164 128 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 197 273 123
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.67%)
Alanine (Ala, A)
n = 7 (4.02%)
Serine (Ser, S)
n = 17 (9.77%)
Threonine (Thr, T)
n = 3 (1.72%)
Cysteine (Cys, C)
n = 4 (2.3%)
Valine (Val, V)
n = 26 (14.94%)
Leucine (Leu, L)
n = 27 (15.52%)
Isoleucine (Ile, I)
n = 5 (2.87%)
Methionine (Met, M)
n = 10 (5.75%)
Proline (Pro, P)
n = 4 (2.3%)
Phenylalanine (Phe, F)
n = 16 (9.2%)
Tyrosine (Tyr, Y)
n = 12 (6.9%)
Tryptophan (Trp, W)
n = 4 (2.3%)
Aspartic acid (Asp, D)
n = 2 (1.15%)
Glutamic acid (Glu, E)
n = 4 (2.3%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.57%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 2 0 0 1 10 0 0 12 1 2 11 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 4 0 4 0 1 2 10 1 8 10 3 0 0 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 10 0 3 0 4 0 9 3 2 14 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 2 2 0 0 0 1 0 1 0 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 10 24 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 27 20 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 5 33 84
Total protein-coding genes (size: 11418 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 226 (5.94%)
Alanine (Ala, A)
n = 244 (6.42%)
Serine (Ser, S)
n = 282 (7.42%)
Threonine (Thr, T)
n = 349 (9.18%)
Cysteine (Cys, C)
n = 33 (0.87%)
Valine (Val, V)
n = 163 (4.29%)
Leucine (Leu, L)
n = 617 (16.22%)
Isoleucine (Ile, I)
n = 307 (8.07%)
Methionine (Met, M)
n = 241 (6.34%)
Proline (Pro, P)
n = 211 (5.55%)
Phenylalanine (Phe, F)
n = 218 (5.73%)
Tyrosine (Tyr, Y)
n = 138 (3.63%)
Tryptophan (Trp, W)
n = 109 (2.87%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 88 (2.31%)
Asparagine (Asn, N)
n = 138 (3.63%)
Glutamine (Gln, Q)
n = 102 (2.68%)
Histidine (His, H)
n = 100 (2.63%)
Lysine (Lys, K)
n = 97 (2.55%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
161 146 214 69 82 256 19 167 94 8 25 27 87 24 93 125
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
27 12 21 58 94 85 7 34 62 101 29 31 36 139 5 77
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
109 160 3 53 63 118 5 15 28 60 78 11 24 45 93 43
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
57 79 9 29 36 93 4 5 12 47 4 1 1 6 0 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
786 907 1177 934
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
481 1043 734 1546
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
180 1069 1745 810

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.