Viewing data for Alcelaphus buselaphus


Scientific name Alcelaphus buselaphus
Common name Hartebeest
Maximum lifespan 22.50 years (Alcelaphus buselaphus@AnAge)

Total mtDNA (size: 16373 bases) GC AT G C A T
Base content (bases) 6790 9583 4457 2333 4224 5359
Base content per 1 kb (bases) 415 585 272 142 258 327
Base content (%) 41.5% 58.5%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4780 6558 3305 1475 2984 3574
Base content per 1 kb (bases) 422 578 291 130 263 315
Base content (%) 42.2% 57.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1514 bases) GC AT G C A T
Base content (bases) 574 940 331 243 411 529
Base content per 1 kb (bases) 379 621 219 161 271 349
Base content (%) 37.9% 62.1%
Total rRNA-coding genes (size: 2521 bases) GC AT G C A T
Base content (bases) 1021 1500 563 458 566 934
Base content per 1 kb (bases) 405 595 223 182 225 370
Base content (%) 40.5% 59.5%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 403 550 228 175 205 345
Base content per 1 kb (bases) 423 577 239 184 215 362
Base content (%) 42.3% 57.7%
16S rRNA gene (size: 1568 bases) GC AT G C A T
Base content (bases) 618 950 335 283 361 589
Base content per 1 kb (bases) 394 606 214 180 230 376
Base content (%) 39.4% 60.6%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 290 391 208 82 178 213
Base content per 1 kb (bases) 426 574 305 120 261 313
Base content (%) 42.6% 57.4%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 68 133 52 16 56 77
Base content per 1 kb (bases) 338 662 259 80 279 383
Base content (%) 33.8% 66.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 692 853 417 275 426 427
Base content per 1 kb (bases) 448 552 270 178 276 276
Base content (%) 44.8% 55.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 269 415 163 106 180 235
Base content per 1 kb (bases) 393 607 238 155 263 344
Base content (%) 39.3% 60.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 360 424 244 116 216 208
Base content per 1 kb (bases) 459 541 311 148 276 265
Base content (%) 45.9% 54.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 503 637 344 159 286 351
Base content per 1 kb (bases) 441 559 302 139 251 308
Base content (%) 44.1% 55.9%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 401 555 277 124 262 293
Base content per 1 kb (bases) 419 581 290 130 274 306
Base content (%) 41.9% 58.1%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 395 647 290 105 278 369
Base content per 1 kb (bases) 379 621 278 101 267 354
Base content (%) 37.9% 62.1%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 153 193 110 43 89 104
Base content per 1 kb (bases) 442 558 318 124 257 301
Base content (%) 44.2% 55.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 588 790 425 163 367 423
Base content per 1 kb (bases) 427 573 308 118 266 307
Base content (%) 42.7% 57.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 122 175 82 40 89 86
Base content per 1 kb (bases) 411 589 276 135 300 290
Base content (%) 41.1% 58.9%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 756 1065 549 207 473 592
Base content per 1 kb (bases) 415 585 301 114 260 325
Base content (%) 41.5% 58.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 204 324 158 46 106 218
Base content per 1 kb (bases) 386 614 299 87 201 413
Base content (%) 38.6% 61.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 8 9 6 19 4 6 9 0 1 3 7 1 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 1 9 7 0 1 3 5 2 2 4 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 13 0 2 2 5 0 0 6 0 2 1 1 2 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 1 0 3 1 0 2 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 69 80 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 62 37 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 77 96 40
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLVLFIIFQLKVSKHNFYHNPELAPTKTLKQNIPWESKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 5 (7.58%)
Threonine (Thr, T)
n = 6 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.03%)
Leucine (Leu, L)
n = 12 (18.18%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 3 (4.55%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 1 2 1 5 1 2 3 0 0 2 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 1 0 0 0 0 0 2 1 2 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 1 0 0 5 0 0 0 1 1 0 1 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 6 0 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 20 23 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 18 20 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 14 34 12
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 16 25 8 8 23 12 8 4 2 6 9 14 9 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 8 13 16 3 2 15 20 10 8 8 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 20 1 5 10 13 0 0 3 8 11 1 0 4 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 1 2 13 8 1 1 1 5 1 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 110 140 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 172 192 101
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 6 3 2 14 3 10 5 1 3 2 7 1 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 0 2 1 1 3 3 1 2 5 0 0 4 7 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 2 4 9 1 1 4 8 3 1 0 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 14 1 4 6 5 1 0 1 4 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 54 69 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 54 105 43
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 5 8 8 7 15 3 0 5 2 2 6 6 1 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 8 3 1 1 8 9 2 2 7 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 1 2 5 8 1 2 2 5 6 0 0 2 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 0 3 2 0 0 3 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 74 62 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 102 92 54
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 17 (4.49%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 27 14 6 11 34 2 6 4 2 1 8 7 1 8 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 1 10 15 2 0 7 13 4 3 6 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 1 3 5 10 1 0 3 5 10 0 0 4 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 1 1 11 7 2 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 101 111 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 94 77 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 149 163 48
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 16 (5.05%)
Leucine (Leu, L)
n = 57 (17.98%)
Isoleucine (Ile, I)
n = 27 (8.52%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 18 1 14 31 4 5 7 0 4 3 9 0 11 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 12 14 1 1 5 5 1 3 10 5 4 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 1 2 4 11 2 1 2 5 6 1 2 4 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 2 1 6 1 0 1 6 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 91 90 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 55 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 96 147 54
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 37 5 9 24 8 7 10 0 4 5 3 0 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 2 12 5 1 1 4 7 2 0 7 9 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 2 11 14 0 0 2 5 3 0 1 2 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 2 1 0 11 2 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 82 147 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 102 58 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 106 164 53
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 37 5 9 24 8 7 10 0 4 5 3 0 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 2 12 5 1 1 4 7 2 0 7 9 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 2 11 14 0 0 2 5 3 0 1 2 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 2 1 0 11 2 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 82 147 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 102 58 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 106 164 53
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 34 (7.42%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 33 (7.21%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 23 24 6 20 46 15 11 10 1 3 5 8 0 7 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 3 2 14 11 2 1 9 5 3 2 11 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 20 2 3 18 7 0 2 9 7 9 0 0 5 18 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 0 0 4 11 0 2 2 6 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 139 153 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 111 84 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 175 186 65
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 11 1 4 9 2 5 2 0 1 1 3 2 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 2 7 0 0 2 2 0 1 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 0 0 1 8 0 0 1 0 2 2 0 1 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 0 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 22 27 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 37 42 12
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 49 (8.09%)
Threonine (Thr, T)
n = 56 (9.24%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 15 (2.48%)
Leucine (Leu, L)
n = 88 (14.52%)
Isoleucine (Ile, I)
n = 61 (10.07%)
Methionine (Met, M)
n = 40 (6.6%)
Proline (Pro, P)
n = 28 (4.62%)
Phenylalanine (Phe, F)
n = 45 (7.43%)
Tyrosine (Tyr, Y)
n = 21 (3.47%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 35 30 9 23 39 7 9 17 2 4 5 5 1 14 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 4 3 13 23 2 5 8 12 3 1 17 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 26 4 3 16 15 1 2 12 8 13 0 1 14 21 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 3 2 8 21 1 0 5 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 145 228 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 160 132 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 244 232 96
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 18 (10.29%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 0 2 0 0 2 1 9 0 1 10 0 1 11 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 3 2 0 1 9 2 2 13 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 3 5 0 2 0 4 0 7 3 2 6 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 2 2 1 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 8 49 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 32 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 12 25 84
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 252 (6.64%)
Serine (Ser, S)
n = 280 (7.37%)
Threonine (Thr, T)
n = 310 (8.16%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 188 (4.95%)
Leucine (Leu, L)
n = 604 (15.9%)
Isoleucine (Ile, I)
n = 328 (8.64%)
Methionine (Met, M)
n = 258 (6.79%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 238 (6.27%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 161 (4.24%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 94 (2.47%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
164 164 191 60 113 271 63 84 78 12 39 51 71 27 107 131
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
67 2 20 24 104 108 16 22 65 88 40 28 79 73 13 33
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
104 158 15 31 83 101 7 13 45 62 71 7 13 48 113 21
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
73 79 17 16 51 84 11 4 16 39 4 1 0 6 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
818 947 1211 823
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 977 743 1616
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
313 1283 1529 674

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.