Viewing data for Allenopithecus nigroviridis


Scientific name Allenopithecus nigroviridis
Common name Allen's swamp monkey
Maximum lifespan 27.00 years (Allenopithecus nigroviridis@AnAge)

Total mtDNA (size: 16517 bases) GC AT G C A T
Base content (bases) 6751 9766 4732 2019 4424 5342
Base content per 1 kb (bases) 409 591 286 122 268 323
Base content (%) 40.9% 59.1%
Total protein-coding genes (size: 11364 bases) GC AT G C A T
Base content (bases) 4622 6742 3394 1228 3149 3593
Base content per 1 kb (bases) 407 593 299 108 277 316
Base content (%) 40.7% 59.3%
D-loop (size: 1072 bases) GC AT G C A T
Base content (bases) 477 595 342 135 284 311
Base content per 1 kb (bases) 445 555 319 126 265 290
Base content (%) 44.5% 55.5%
Total tRNA-coding genes (size: 1496 bases) GC AT G C A T
Base content (bases) 562 934 344 218 400 534
Base content per 1 kb (bases) 376 624 230 146 267 357
Base content (%) 37.6% 62.4%
Total rRNA-coding genes (size: 2512 bases) GC AT G C A T
Base content (bases) 1054 1458 618 436 575 883
Base content per 1 kb (bases) 420 580 246 174 229 352
Base content (%) 42.0% 58.0%
12S rRNA gene (size: 949 bases) GC AT G C A T
Base content (bases) 410 539 241 169 215 324
Base content per 1 kb (bases) 432 568 254 178 227 341
Base content (%) 43.2% 56.8%
16S rRNA gene (size: 1563 bases) GC AT G C A T
Base content (bases) 644 919 377 267 360 559
Base content per 1 kb (bases) 412 588 241 171 230 358
Base content (%) 41.2% 58.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 267 414 206 61 192 222
Base content per 1 kb (bases) 392 608 302 90 282 326
Base content (%) 39.2% 60.8%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 73 134 59 14 50 84
Base content per 1 kb (bases) 353 647 285 68 242 406
Base content (%) 35.3% 64.7%
COX1 (size: 1569 bases) GC AT G C A T
Base content (bases) 666 903 416 250 472 431
Base content per 1 kb (bases) 424 576 265 159 301 275
Base content (%) 42.4% 57.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 273 411 188 85 188 223
Base content per 1 kb (bases) 399 601 275 124 275 326
Base content (%) 39.9% 60.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 348 436 241 107 226 210
Base content per 1 kb (bases) 444 556 307 136 288 268
Base content (%) 44.4% 55.6%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 490 651 367 123 310 341
Base content per 1 kb (bases) 429 571 322 108 272 299
Base content (%) 42.9% 57.1%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 406 549 307 99 254 295
Base content per 1 kb (bases) 425 575 321 104 266 309
Base content (%) 42.5% 57.5%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 427 615 346 81 256 359
Base content per 1 kb (bases) 410 590 332 78 246 345
Base content (%) 41.0% 59.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 130 216 98 32 102 114
Base content per 1 kb (bases) 376 624 283 92 295 329
Base content (%) 37.6% 62.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 529 849 400 129 404 445
Base content per 1 kb (bases) 384 616 290 94 293 323
Base content (%) 38.4% 61.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 109 188 78 31 97 91
Base content per 1 kb (bases) 367 633 263 104 327 306
Base content (%) 36.7% 63.3%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 721 1091 534 187 508 583
Base content per 1 kb (bases) 398 602 295 103 280 322
Base content (%) 39.8% 60.2%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 201 321 166 35 106 215
Base content per 1 kb (bases) 385 615 318 67 203 412
Base content (%) 38.5% 61.5%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.1%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 11 (4.87%)
Threonine (Thr, T)
n = 28 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 48 (21.24%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 8 (3.54%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 14 (6.19%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 8 (3.54%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 11 11 6 7 23 3 8 8 0 2 2 6 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 6 3 0 1 3 3 0 3 5 5 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 11 1 3 2 2 0 1 3 1 1 0 1 6 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 1 0 0 5 0 1 1 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 73 90 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 65 41 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 68 91 58
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDTSTWFITIMTMLPTLYLIMQLKLLNTNYYQRPLQKSPNKQTSNNYWQLKWTKIYLPRLQLRQF*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (4.41%)
Threonine (Thr, T)
n = 8 (11.76%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 12 (17.65%)
Isoleucine (Ile, I)
n = 4 (5.88%)
Methionine (Met, M)
n = 4 (5.88%)
Proline (Pro, P)
n = 5 (7.35%)
Phenylalanine (Phe, F)
n = 2 (2.94%)
Tyrosine (Tyr, Y)
n = 5 (7.35%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (7.35%)
Glutamine (Gln, Q)
n = 8 (11.76%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (7.35%)
Arginine (Arg, R)
n = 3 (4.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 3 1 1 5 1 4 6 2 0 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 0 5 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 1 0 2 0 0 0 1 1 4 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 1 0 4 1 2 0 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 24 27 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 15 25 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 20 32 11
COX1 (size: 1569 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.2%)
Alanine (Ala, A)
n = 37 (7.09%)
Serine (Ser, S)
n = 32 (6.13%)
Threonine (Thr, T)
n = 36 (6.9%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.9%)
Leucine (Leu, L)
n = 63 (12.07%)
Isoleucine (Ile, I)
n = 41 (7.85%)
Methionine (Met, M)
n = 30 (5.75%)
Proline (Pro, P)
n = 30 (5.75%)
Phenylalanine (Phe, F)
n = 42 (8.05%)
Tyrosine (Tyr, Y)
n = 21 (4.02%)
Tryptophan (Trp, W)
n = 16 (3.07%)
Aspartic acid (Asp, D)
n = 14 (2.68%)
Glutamic acid (Glu, E)
n = 11 (2.11%)
Asparagine (Asn, N)
n = 19 (3.64%)
Glutamine (Gln, Q)
n = 7 (1.34%)
Histidine (His, H)
n = 18 (3.45%)
Lysine (Lys, K)
n = 11 (2.11%)
Arginine (Arg, R)
n = 9 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 20 24 10 8 32 3 9 7 0 9 10 15 2 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 13 12 11 1 10 13 19 6 10 12 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 1 8 9 10 0 2 3 8 13 1 1 8 11 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 3 5 9 10 1 2 3 4 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 117 142 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 130 102 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 169 187 142
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 23 (10.13%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 8 (3.52%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 11 1 5 18 0 6 7 0 1 6 2 1 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 4 6 3 0 2 3 6 0 6 3 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 4 2 4 1 1 1 3 7 0 0 4 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 5 3 4 0 1 1 4 0 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 57 73 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 56 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 71 94 56
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 12 (4.62%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 31 (11.92%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 11 (4.23%)
Leucine (Leu, L)
n = 37 (14.23%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 6 (2.31%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 6 3 6 19 1 6 8 0 4 3 4 0 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 5 4 3 0 4 9 4 3 2 5 4 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 11 1 3 5 7 1 1 3 9 4 0 2 1 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 5 1 2 1 1 1 1 1 2 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 72 64 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 71 54 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 98 92 58
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (5.54%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 11 (2.9%)
Leucine (Leu, L)
n = 65 (17.15%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 21 (5.54%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 23 (6.07%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 3 (0.79%)
Asparagine (Asn, N)
n = 19 (5.01%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 9 (2.37%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 28 19 13 14 25 3 9 9 0 0 5 6 0 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 3 6 12 0 4 11 5 1 2 8 15 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 3 12 9 0 1 2 2 14 2 1 5 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 0 2 8 10 0 1 3 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 106 120 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 98 76 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 163 145 62
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 24 (7.57%)
Serine (Ser, S)
n = 24 (7.57%)
Threonine (Thr, T)
n = 34 (10.73%)
Cysteine (Cys, C)
n = 3 (0.95%)
Valine (Val, V)
n = 7 (2.21%)
Leucine (Leu, L)
n = 62 (19.56%)
Isoleucine (Ile, I)
n = 23 (7.26%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 19 (5.99%)
Tyrosine (Tyr, Y)
n = 9 (2.84%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 15 (4.73%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 15 10 14 32 1 5 6 0 0 4 3 0 8 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 4 13 7 0 1 6 5 0 5 12 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 23 0 4 5 12 0 0 3 1 8 1 0 4 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 2 1 6 1 1 1 5 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 95 100 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 101 54 129
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 111 141 58
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 11 (3.18%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 55 (15.9%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 27 (7.8%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 21 (6.07%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 27 26 7 11 25 4 9 10 1 0 3 3 1 4 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 5 3 0 2 6 6 1 3 9 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 22 2 7 9 8 1 0 3 4 5 0 0 3 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 0 10 0 0 3 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 90 150 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 113 63 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 143 146 46
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 11 (3.18%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 55 (15.9%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 27 (7.8%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 21 (6.07%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 27 26 7 11 25 4 9 10 1 0 3 3 1 4 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 5 3 0 2 6 6 1 3 9 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 22 2 7 9 8 1 0 3 4 5 0 0 3 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 0 0 0 10 0 0 3 0 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 90 150 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 113 63 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 143 146 46
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.28%)
Alanine (Ala, A)
n = 24 (5.24%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 49 (10.7%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 87 (19.0%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 38 (8.3%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 15 (3.28%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 8 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 24 35 20 12 36 4 15 10 0 4 2 7 0 13 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 4 11 8 1 3 5 4 3 5 11 7 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 22 1 5 17 6 1 2 8 7 8 1 0 10 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 1 2 2 12 0 0 2 5 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 128 171 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 125 88 198
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 147 186 110
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 10 (10.2%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 5 9 3 3 11 0 4 2 0 0 1 2 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 3 2 0 1 2 1 0 1 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 1 2 4 1 0 1 2 1 0 0 4 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 0 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 25 32 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 29 42 25
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.15%)
Alanine (Ala, A)
n = 39 (6.47%)
Serine (Ser, S)
n = 54 (8.96%)
Threonine (Thr, T)
n = 64 (10.61%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 15 (2.49%)
Leucine (Leu, L)
n = 98 (16.25%)
Isoleucine (Ile, I)
n = 53 (8.79%)
Methionine (Met, M)
n = 42 (6.97%)
Proline (Pro, P)
n = 26 (4.31%)
Phenylalanine (Phe, F)
n = 33 (5.47%)
Tyrosine (Tyr, Y)
n = 19 (3.15%)
Tryptophan (Trp, W)
n = 13 (2.16%)
Aspartic acid (Asp, D)
n = 13 (2.16%)
Glutamic acid (Glu, E)
n = 9 (1.49%)
Asparagine (Asn, N)
n = 35 (5.8%)
Glutamine (Gln, Q)
n = 19 (3.15%)
Histidine (His, H)
n = 12 (1.99%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 30 34 17 21 41 4 14 17 2 3 6 6 0 16 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 5 5 23 11 0 5 12 6 2 6 6 14 0 22
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 23 1 11 14 14 1 4 10 6 13 0 1 9 26 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 1 5 8 20 1 1 4 3 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 148 229 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 169 129 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 217 225 141
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.76%)
Alanine (Ala, A)
n = 7 (4.05%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 6 (3.47%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 23 (13.29%)
Leucine (Leu, L)
n = 22 (12.72%)
Isoleucine (Ile, I)
n = 14 (8.09%)
Methionine (Met, M)
n = 12 (6.94%)
Proline (Pro, P)
n = 3 (1.73%)
Phenylalanine (Phe, F)
n = 10 (5.78%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 9 (5.2%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 7 2 0 1 0 9 0 0 11 0 4 8 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 4 0 2 1 13 1 6 9 2 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 0 4 0 0 2 6 0 7 2 3 10 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 4 0 0 1 1 0 1 1 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 9 42 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 22 25 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 4 39 83
Total protein-coding genes (size: 11418 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 209 (5.5%)
Alanine (Ala, A)
n = 219 (5.76%)
Serine (Ser, S)
n = 278 (7.31%)
Threonine (Thr, T)
n = 377 (9.91%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 147 (3.87%)
Leucine (Leu, L)
n = 627 (16.49%)
Isoleucine (Ile, I)
n = 334 (8.78%)
Methionine (Met, M)
n = 241 (6.34%)
Proline (Pro, P)
n = 207 (5.44%)
Phenylalanine (Phe, F)
n = 219 (5.76%)
Tyrosine (Tyr, Y)
n = 134 (3.52%)
Tryptophan (Trp, W)
n = 102 (2.68%)
Aspartic acid (Asp, D)
n = 64 (1.68%)
Glutamic acid (Glu, E)
n = 84 (2.21%)
Asparagine (Asn, N)
n = 178 (4.68%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
153 181 205 97 103 282 26 102 93 5 34 42 59 12 99 120
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
36 9 15 57 94 65 3 47 71 66 25 45 82 76 4 78
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
126 165 8 53 81 78 9 18 39 53 81 9 17 59 119 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
65 66 18 29 35 86 6 11 21 29 4 0 1 5 1 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
723 976 1280 825
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
458 1024 754 1568
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
184 1275 1470 875

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.