Viewing data for Anas crecca


Scientific name Anas crecca
Common name Green-winged teal
Maximum lifespan 27.10 years (Anas crecca@AnAge)

Total mtDNA (size: 16601 bases) GC AT G C A T
Base content (bases) 8068 8533 5418 2650 3711 4822
Base content per 1 kb (bases) 486 514 326 160 224 290
Base content (%) 48.6% 51.4%
Total protein-coding genes (size: 11388 bases) GC AT G C A T
Base content (bases) 5677 5711 3995 1682 2540 3171
Base content per 1 kb (bases) 499 501 351 148 223 278
Base content (%) 49.9% 50.1%
D-loop (size: 1046 bases) GC AT G C A T
Base content (bases) 485 561 318 167 273 288
Base content per 1 kb (bases) 464 536 304 160 261 275
Base content (%) 46.4% 53.6%
Total tRNA-coding genes (size: 1539 bases) GC AT G C A T
Base content (bases) 668 871 396 272 379 492
Base content per 1 kb (bases) 434 566 257 177 246 320
Base content (%) 43.4% 56.6%
Total rRNA-coding genes (size: 2589 bases) GC AT G C A T
Base content (bases) 1213 1376 690 523 511 865
Base content per 1 kb (bases) 469 531 267 202 197 334
Base content (%) 46.9% 53.1%
12S rRNA gene (size: 988 bases) GC AT G C A T
Base content (bases) 488 500 280 208 188 312
Base content per 1 kb (bases) 494 506 283 211 190 316
Base content (%) 49.4% 50.6%
16S rRNA gene (size: 1601 bases) GC AT G C A T
Base content (bases) 725 876 410 315 323 553
Base content per 1 kb (bases) 453 547 256 197 202 345
Base content (%) 45.3% 54.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 338 346 255 83 155 191
Base content per 1 kb (bases) 494 506 373 121 227 279
Base content (%) 49.4% 50.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 80 88 66 14 30 58
Base content per 1 kb (bases) 476 524 393 83 179 345
Base content (%) 47.6% 52.4%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 775 776 507 268 373 403
Base content per 1 kb (bases) 500 500 327 173 240 260
Base content (%) 50.0% 50.0%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 336 351 223 113 154 197
Base content per 1 kb (bases) 489 511 325 164 224 287
Base content (%) 48.9% 51.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 394 390 264 130 186 204
Base content per 1 kb (bases) 503 497 337 166 237 260
Base content (%) 50.3% 49.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 570 573 397 173 276 297
Base content per 1 kb (bases) 499 501 347 151 241 260
Base content (%) 49.9% 50.1%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 493 485 336 157 235 250
Base content per 1 kb (bases) 504 496 344 161 240 256
Base content (%) 50.4% 49.6%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 507 532 380 127 222 310
Base content per 1 kb (bases) 488 512 366 122 214 298
Base content (%) 48.8% 51.2%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 179 173 124 55 85 88
Base content per 1 kb (bases) 509 491 352 156 241 250
Base content (%) 50.9% 49.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 670 708 490 180 314 394
Base content per 1 kb (bases) 486 514 356 131 228 286
Base content (%) 48.6% 51.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 158 139 105 53 69 70
Base content per 1 kb (bases) 532 468 354 178 232 236
Base content (%) 53.2% 46.8%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 917 907 651 266 388 519
Base content per 1 kb (bases) 503 497 357 146 213 285
Base content (%) 50.3% 49.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 264 258 199 65 58 200
Base content per 1 kb (bases) 506 494 381 125 111 383
Base content (%) 50.6% 49.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 18 6 5 13 22 10 10 4 3 1 3 2 1 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 1 12 6 0 1 4 1 1 1 8 7 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 0 7 4 0 0 5 0 3 1 1 1 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 1 0 1 4 0 0 1 3 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 84 68 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 66 36 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 105 87 12
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMIMTWLTLALLIQPKLLTFTTTNPPSKKPSLTTKPTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 2 0 4 3 1 0 1 1 0 0 0 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 1 3 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 0 0 2 1 0 0 0 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 2 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 20 22 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 26 9 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 20 27 3
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 43 (8.33%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 34 17 5 17 25 10 6 9 1 4 14 12 4 13 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 7 30 8 1 4 14 21 8 5 11 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 14 2 4 10 9 1 0 3 1 16 0 0 1 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 2 2 13 8 1 0 1 6 1 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 124 134 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 244 174 60
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.89%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 8 (3.51%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 6 1 12 10 3 4 6 1 4 4 7 3 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 1 12 3 0 0 3 4 2 3 3 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 1 2 5 11 0 0 3 1 8 1 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 12 2 0 13 3 1 1 1 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 61 50 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 62 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 102 85 24
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 12 7 0 12 14 2 4 5 1 2 8 4 1 5 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 13 5 1 1 8 8 2 1 4 5 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 1 1 5 6 1 0 5 3 6 1 0 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 7 1 0 5 3 1 0 0 4 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 69 58 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 126 92 26
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 30 (7.89%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 20 (5.26%)
Leucine (Leu, L)
n = 64 (16.84%)
Isoleucine (Ile, I)
n = 27 (7.11%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 23 5 8 15 26 11 3 6 2 1 7 10 2 9 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 5 4 18 7 1 0 9 8 6 2 9 13 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 9 0 2 9 9 3 0 2 2 11 3 1 3 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 1 0 7 9 1 0 2 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 112 94 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 78 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 182 125 37
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 33 (10.15%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 61 (18.77%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 16 (4.92%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 10 (3.08%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 18 11 2 18 28 10 2 5 1 1 6 7 3 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 2 20 11 0 1 5 6 2 6 12 5 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 2 1 10 8 2 0 6 5 9 4 1 1 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 0 4 7 0 1 0 5 2 0 1 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 99 82 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 97 54 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 140 114 33
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 38 (11.01%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 36 (10.43%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 13 (3.77%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 24 (6.96%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 22 10 6 16 38 3 3 6 3 0 8 5 0 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 6 15 16 1 0 6 3 2 1 11 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 4 11 8 2 1 6 3 4 3 1 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 1 10 4 0 2 1 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 109 110 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 123 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 148 142 29
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 38 (11.01%)
Serine (Ser, S)
n = 32 (9.28%)
Threonine (Thr, T)
n = 36 (10.43%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 13 (3.77%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 24 (6.96%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 22 10 6 16 38 3 3 6 3 0 8 5 0 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 6 15 16 1 0 6 3 2 1 11 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 1 4 11 8 2 1 6 3 4 3 1 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 1 10 4 0 2 1 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 109 110 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 123 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 148 142 29
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 48 (10.48%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 102 (22.27%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 10 (2.18%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 31 17 10 21 43 19 8 10 1 0 5 5 0 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 3 19 9 1 0 8 7 5 1 13 12 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 22 0 3 13 12 1 2 8 3 11 1 1 1 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 5 1 2 8 2 0 2 8 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 158 143 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 138 73 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 194 178 39
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 4 3 1 6 6 1 2 0 1 0 2 1 0 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 0 6 3 0 0 4 1 1 0 2 0 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 0 4 3 2 0 4 0 1 0 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 0 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 29 24 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 28 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 48 30 7
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.6%)
Alanine (Ala, A)
n = 60 (9.88%)
Serine (Ser, S)
n = 40 (6.59%)
Threonine (Thr, T)
n = 67 (11.04%)
Cysteine (Cys, C)
n = 7 (1.15%)
Valine (Val, V)
n = 19 (3.13%)
Leucine (Leu, L)
n = 107 (17.63%)
Isoleucine (Ile, I)
n = 50 (8.24%)
Methionine (Met, M)
n = 27 (4.45%)
Proline (Pro, P)
n = 31 (5.11%)
Phenylalanine (Phe, F)
n = 33 (5.44%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.15%)
Glutamic acid (Glu, E)
n = 14 (2.31%)
Asparagine (Asn, N)
n = 23 (3.79%)
Glutamine (Gln, Q)
n = 19 (3.13%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 23 (3.79%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 43 21 6 30 50 15 6 13 6 1 5 11 2 9 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 7 9 33 15 3 2 13 11 8 1 15 14 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
35 21 1 1 20 6 2 0 11 3 8 6 0 3 20 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 5 0 7 19 4 1 5 3 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
134 174 201 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 187 112 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 290 206 53
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 15 (8.67%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 37 (21.39%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 6 (3.47%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 0 3 1 1 7 5 0 1 17 0 6 14 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 5 2 4 4 3 2 5 17 3 0 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 0 1 3 2 1 5 1 3 9 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 2 1 0 0 0 0 0 5 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 23 16 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 31 16 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
72 11 26 65
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.84%)
Alanine (Ala, A)
n = 338 (8.89%)
Serine (Ser, S)
n = 281 (7.39%)
Threonine (Thr, T)
n = 311 (8.18%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 196 (5.16%)
Leucine (Leu, L)
n = 667 (17.55%)
Isoleucine (Ile, I)
n = 277 (7.29%)
Methionine (Met, M)
n = 165 (4.34%)
Proline (Pro, P)
n = 231 (6.08%)
Phenylalanine (Phe, F)
n = 222 (5.84%)
Tyrosine (Tyr, Y)
n = 106 (2.79%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 118 (3.11%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 109 (2.87%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
55 222 109 50 169 282 99 52 69 23 32 60 72 32 62 160
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
56 2 27 45 188 93 12 12 77 78 55 25 96 98 12 32
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
147 124 8 23 97 82 19 6 54 26 80 25 15 13 105 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
103 72 24 5 58 74 16 3 16 39 13 0 2 7 1 82
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
915 1103 1023 760
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
491 1101 682 1527
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
412 1659 1333 397

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.