Viewing data for Lethenteron camtschaticum


Scientific name Lethenteron camtschaticum
Common name Arctic lamprey
Maximum lifespan 7.00 years (Lethenteron camtschaticum@AnAge)

Total mtDNA (size: 16277 bases) GC AT G C A T
Base content (bases) 6157 10120 3894 2263 4938 5182
Base content per 1 kb (bases) 378 622 239 139 303 318
Base content (%) 37.8% 62.2%
Total protein-coding genes (size: 11372 bases) GC AT G C A T
Base content (bases) 4280 7092 2830 1450 3553 3539
Base content per 1 kb (bases) 376 624 249 128 312 311
Base content (%) 37.6% 62.4%
D-loop (size: 757 bases) GC AT G C A T
Base content (bases) 226 531 140 86 298 233
Base content per 1 kb (bases) 299 701 185 114 394 308
Base content (%) 29.9% 70.1%
Total tRNA-coding genes (size: 1529 bases) GC AT G C A T
Base content (bases) 599 930 334 265 435 495
Base content per 1 kb (bases) 392 608 218 173 284 324
Base content (%) 39.2% 60.8%
Total rRNA-coding genes (size: 2518 bases) GC AT G C A T
Base content (bases) 1024 1494 566 458 612 882
Base content per 1 kb (bases) 407 593 225 182 243 350
Base content (%) 40.7% 59.3%
12S rRNA gene (size: 901 bases) GC AT G C A T
Base content (bases) 405 496 233 172 200 296
Base content per 1 kb (bases) 450 550 259 191 222 329
Base content (%) 45.0% 55.0%
16S rRNA gene (size: 1617 bases) GC AT G C A T
Base content (bases) 619 998 333 286 412 586
Base content per 1 kb (bases) 383 617 206 177 255 362
Base content (%) 38.3% 61.7%

ATP6 (size: 714 bases) GC AT G C A T
Base content (bases) 265 449 189 76 230 219
Base content per 1 kb (bases) 371 629 265 106 322 307
Base content (%) 37.1% 62.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 62 106 45 17 49 57
Base content per 1 kb (bases) 369 631 268 101 292 339
Base content (%) 36.9% 63.1%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 602 952 357 245 511 441
Base content per 1 kb (bases) 387 613 230 158 329 284
Base content (%) 38.7% 61.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 271 413 167 104 197 216
Base content per 1 kb (bases) 396 604 244 152 288 316
Base content (%) 39.6% 60.4%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 332 454 211 121 234 220
Base content per 1 kb (bases) 422 578 268 154 298 280
Base content (%) 42.2% 57.8%
CYTB (size: 1191 bases) GC AT G C A T
Base content (bases) 452 739 277 175 402 337
Base content per 1 kb (bases) 380 620 233 147 338 283
Base content (%) 38.0% 62.0%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 360 606 229 131 329 277
Base content per 1 kb (bases) 373 627 237 136 341 287
Base content (%) 37.3% 62.7%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 371 671 255 116 326 345
Base content per 1 kb (bases) 356 644 245 111 313 331
Base content (%) 35.6% 64.4%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 137 214 94 43 123 91
Base content per 1 kb (bases) 390 610 268 123 350 259
Base content (%) 39.0% 61.0%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 493 884 351 142 454 430
Base content per 1 kb (bases) 358 642 255 103 330 312
Base content (%) 35.8% 64.2%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 112 179 81 31 85 94
Base content per 1 kb (bases) 385 615 278 107 292 323
Base content (%) 38.5% 61.5%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 660 1137 455 205 542 595
Base content per 1 kb (bases) 367 633 253 114 302 331
Base content (%) 36.7% 63.3%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 196 323 140 56 84 239
Base content per 1 kb (bases) 378 622 270 108 162 461
Base content (%) 37.8% 62.2%

ATP6 (size: 714 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.8%)
Alanine (Ala, A)
n = 19 (8.02%)
Serine (Ser, S)
n = 12 (5.06%)
Threonine (Thr, T)
n = 23 (9.7%)
Cysteine (Cys, C)
n = 1 (0.42%)
Valine (Val, V)
n = 10 (4.22%)
Leucine (Leu, L)
n = 50 (21.1%)
Isoleucine (Ile, I)
n = 26 (10.97%)
Methionine (Met, M)
n = 14 (5.91%)
Proline (Pro, P)
n = 19 (8.02%)
Phenylalanine (Phe, F)
n = 10 (4.22%)
Tyrosine (Tyr, Y)
n = 6 (2.53%)
Tryptophan (Trp, W)
n = 3 (1.27%)
Aspartic acid (Asp, D)
n = 1 (0.42%)
Glutamic acid (Glu, E)
n = 5 (2.11%)
Asparagine (Asn, N)
n = 6 (2.53%)
Glutamine (Gln, Q)
n = 9 (3.8%)
Histidine (His, H)
n = 5 (2.11%)
Lysine (Lys, K)
n = 5 (2.11%)
Arginine (Arg, R)
n = 4 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 9 13 7 7 16 1 17 8 1 3 4 3 0 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 7 6 6 0 1 3 3 2 4 2 13 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 1 3 3 1 1 3 1 4 2 0 2 4 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 5 0 0 1 4 1 1 1 2 0 1 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 68 79 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 69 37 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 52 103 73
ATP8 (size: 168 bases)
Amino acid sequence: MPQLEPAPWFSMFTVSWLIILLLIMPTIMFYQTQNTVSAQQATKPKQPTWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 6 (10.91%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 2 1 0 1 0 3 5 1 0 1 0 1 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 2 0 0 0 0 0 0 3 0 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 2 0 1 0 0 0 0 1 0 0 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 1 0 0 2 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 16 18 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 20 13 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 9 26 15
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.51%)
Alanine (Ala, A)
n = 45 (8.7%)
Serine (Ser, S)
n = 28 (5.42%)
Threonine (Thr, T)
n = 41 (7.93%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.35%)
Leucine (Leu, L)
n = 63 (12.19%)
Isoleucine (Ile, I)
n = 40 (7.74%)
Methionine (Met, M)
n = 26 (5.03%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 17 (3.29%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 11 (2.13%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 11 24 13 7 21 1 20 7 0 15 8 10 5 21 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 18 16 11 0 6 8 26 4 9 2 14 3 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 20 0 8 4 11 0 3 2 14 5 0 1 11 6 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 7 8 9 2 4 1 3 0 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 104 141 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 137 97 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 116 203 181
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 25 (11.01%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 7 (3.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 7 8 4 3 12 1 4 8 1 7 3 8 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 2 7 0 2 2 4 2 3 0 9 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 0 3 6 4 0 2 2 5 4 0 1 3 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 14 0 5 6 2 1 0 4 3 0 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 58 61 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 55 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 54 95 70
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.28%)
Alanine (Ala, A)
n = 23 (8.81%)
Serine (Ser, S)
n = 16 (6.13%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 35 (13.41%)
Isoleucine (Ile, I)
n = 11 (4.21%)
Methionine (Met, M)
n = 12 (4.6%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 20 (7.66%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 4 (1.53%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 3 10 3 6 15 1 9 7 0 6 3 7 0 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 6 10 7 0 6 8 5 0 1 3 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 9 1 4 4 4 0 0 4 8 4 0 1 2 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 1 3 2 1 0 1 3 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 64 57 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 56 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 78 107 70
CYTB (size: 1191 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (6.82%)
Alanine (Ala, A)
n = 32 (8.08%)
Serine (Ser, S)
n = 24 (6.06%)
Threonine (Thr, T)
n = 22 (5.56%)
Cysteine (Cys, C)
n = 3 (0.76%)
Valine (Val, V)
n = 18 (4.55%)
Leucine (Leu, L)
n = 54 (13.64%)
Isoleucine (Ile, I)
n = 42 (10.61%)
Methionine (Met, M)
n = 18 (4.55%)
Proline (Pro, P)
n = 22 (5.56%)
Phenylalanine (Phe, F)
n = 31 (7.83%)
Tyrosine (Tyr, Y)
n = 15 (3.79%)
Tryptophan (Trp, W)
n = 11 (2.78%)
Aspartic acid (Asp, D)
n = 9 (2.27%)
Glutamic acid (Glu, E)
n = 7 (1.77%)
Asparagine (Asn, N)
n = 20 (5.05%)
Glutamine (Gln, Q)
n = 8 (2.02%)
Histidine (His, H)
n = 13 (3.28%)
Lysine (Lys, K)
n = 9 (2.27%)
Arginine (Arg, R)
n = 11 (2.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 12 12 10 5 17 3 19 7 1 8 1 8 1 16 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 1 10 10 11 1 5 6 11 5 6 4 11 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 0 8 4 6 2 2 2 7 8 0 0 11 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 2 7 2 7 2 3 1 6 1 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
93 89 116 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 96 81 163
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 92 140 140
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.92%)
Alanine (Ala, A)
n = 30 (9.35%)
Serine (Ser, S)
n = 24 (7.48%)
Threonine (Thr, T)
n = 19 (5.92%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 19 (5.92%)
Leucine (Leu, L)
n = 59 (18.38%)
Isoleucine (Ile, I)
n = 24 (7.48%)
Methionine (Met, M)
n = 18 (5.61%)
Proline (Pro, P)
n = 19 (5.92%)
Phenylalanine (Phe, F)
n = 22 (6.85%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 8 (2.49%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 8 16 14 7 12 0 24 7 1 9 2 7 1 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 9 8 13 0 1 7 9 2 5 5 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 4 0 6 5 9 0 1 3 6 3 0 2 10 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 3 2 1 7 0 1 0 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 69 85 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 88 53 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 72 139 100
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.49%)
Alanine (Ala, A)
n = 28 (8.09%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 23 (6.65%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 9 (2.6%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 5 19 18 7 20 2 15 11 1 2 0 5 0 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 1 9 8 11 0 2 10 5 2 6 1 10 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 0 3 2 12 0 2 6 3 3 0 0 14 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 2 1 10 0 2 0 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 89 132 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 101 61 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 65 152 119
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.49%)
Alanine (Ala, A)
n = 28 (8.09%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 23 (6.65%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 9 (2.6%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 5 19 18 7 20 2 15 11 1 2 0 5 0 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 1 9 8 11 0 2 10 5 2 6 1 10 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 0 3 2 12 0 2 6 3 3 0 0 14 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 2 1 10 0 2 0 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 89 132 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 101 61 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 65 152 119
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.28%)
Alanine (Ala, A)
n = 34 (7.42%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 42 (9.17%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 80 (17.47%)
Isoleucine (Ile, I)
n = 48 (10.48%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 24 (5.24%)
Tyrosine (Tyr, Y)
n = 9 (1.97%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 19 (4.15%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 16 31 17 9 32 0 22 10 0 5 3 5 1 13 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 3 15 10 9 0 3 6 6 0 6 5 11 1 17
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 11 1 9 4 18 0 2 4 8 1 1 0 8 11 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 5 0 4 12 0 2 2 4 1 1 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 113 163 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 130 77 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 108 190 147
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 12 (12.5%)
Serine (Ser, S)
n = 8 (8.33%)
Threonine (Thr, T)
n = 8 (8.33%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 1 (1.04%)
Leucine (Leu, L)
n = 26 (27.08%)
Isoleucine (Ile, I)
n = 4 (4.17%)
Methionine (Met, M)
n = 7 (7.29%)
Proline (Pro, P)
n = 3 (3.13%)
Phenylalanine (Phe, F)
n = 4 (4.17%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 1 (1.04%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 4 (4.17%)
Glutamine (Gln, Q)
n = 2 (2.08%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 2 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 6 4 2 11 1 8 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 0 5 6 1 1 2 0 0 0 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 1 3 3 0 0 1 1 0 0 0 3 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 3 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 27 27 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 30 16 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 24 51 19
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (4.01%)
Alanine (Ala, A)
n = 47 (7.86%)
Serine (Ser, S)
n = 47 (7.86%)
Threonine (Thr, T)
n = 56 (9.36%)
Cysteine (Cys, C)
n = 7 (1.17%)
Valine (Val, V)
n = 15 (2.51%)
Leucine (Leu, L)
n = 94 (15.72%)
Isoleucine (Ile, I)
n = 58 (9.7%)
Methionine (Met, M)
n = 38 (6.35%)
Proline (Pro, P)
n = 28 (4.68%)
Phenylalanine (Phe, F)
n = 34 (5.69%)
Tyrosine (Tyr, Y)
n = 14 (2.34%)
Tryptophan (Trp, W)
n = 14 (2.34%)
Aspartic acid (Asp, D)
n = 9 (1.51%)
Glutamic acid (Glu, E)
n = 15 (2.51%)
Asparagine (Asn, N)
n = 30 (5.02%)
Glutamine (Gln, Q)
n = 18 (3.01%)
Histidine (His, H)
n = 12 (2.01%)
Lysine (Lys, K)
n = 26 (4.35%)
Arginine (Arg, R)
n = 12 (2.01%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
43 15 33 21 9 39 3 21 18 0 4 4 7 0 19 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 4 14 19 12 2 3 5 14 2 9 6 11 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 21 3 7 12 12 1 4 11 8 6 1 1 18 12 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 14 1 5 4 25 1 3 3 6 0 1 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 142 224 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 163 124 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 150 247 180
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (10.47%)
Alanine (Ala, A)
n = 14 (8.14%)
Serine (Ser, S)
n = 11 (6.4%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 6 (3.49%)
Valine (Val, V)
n = 29 (16.86%)
Leucine (Leu, L)
n = 29 (16.86%)
Isoleucine (Ile, I)
n = 5 (2.91%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 19 (11.05%)
Tyrosine (Tyr, Y)
n = 9 (5.23%)
Tryptophan (Trp, W)
n = 3 (1.74%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 3 0 1 2 17 0 0 9 4 7 9 18 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 5 1 11 1 2 0 2 1 5 10 3 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 5 1 2 0 3 0 8 1 1 6 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 0 0 0 2 0 2 0 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 15 22 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 30 20 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 11 42 83
Total protein-coding genes (size: 11440 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 212 (5.56%)
Alanine (Ala, A)
n = 308 (8.08%)
Serine (Ser, S)
n = 262 (6.87%)
Threonine (Thr, T)
n = 304 (7.97%)
Cysteine (Cys, C)
n = 37 (0.97%)
Valine (Val, V)
n = 189 (4.96%)
Leucine (Leu, L)
n = 609 (15.98%)
Isoleucine (Ile, I)
n = 329 (8.63%)
Methionine (Met, M)
n = 214 (5.61%)
Proline (Pro, P)
n = 204 (5.35%)
Phenylalanine (Phe, F)
n = 241 (6.32%)
Tyrosine (Tyr, Y)
n = 112 (2.94%)
Tryptophan (Trp, W)
n = 107 (2.81%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 96 (2.52%)
Asparagine (Asn, N)
n = 143 (3.75%)
Glutamine (Gln, Q)
n = 98 (2.57%)
Histidine (His, H)
n = 101 (2.65%)
Lysine (Lys, K)
n = 93 (2.44%)
Arginine (Arg, R)
n = 75 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
237 92 179 124 65 206 15 184 92 6 69 33 68 19 138 103
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
35 20 17 108 98 98 4 33 60 89 30 55 32 107 10 102
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
78 116 8 64 51 84 4 23 36 73 39 3 15 87 56 47
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
54 81 15 35 32 85 8 19 14 39 3 6 1 4 1 104
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
872 888 1149 904
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
497 1019 715 1582
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
177 860 1542 1234

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.