Viewing data for Trichechus manatus


Scientific name Trichechus manatus
Common name West Indian manatee
Maximum lifespan 65.00 years (Trichechus manatus@AnAge)

Total mtDNA (size: 16882 bases) GC AT G C A T
Base content (bases) 7234 9648 4760 2474 4519 5129
Base content per 1 kb (bases) 429 571 282 147 268 304
Base content (%) 42.9% 57.1%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4955 6383 3416 1539 3111 3272
Base content per 1 kb (bases) 437 563 301 136 274 289
Base content (%) 43.7% 56.3%
D-loop (size: 1443 bases) GC AT G C A T
Base content (bases) 625 818 413 212 378 440
Base content per 1 kb (bases) 433 567 286 147 262 305
Base content (%) 43.3% 56.7%
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 578 933 333 245 419 514
Base content per 1 kb (bases) 383 617 220 162 277 340
Base content (%) 38.3% 61.7%
Total rRNA-coding genes (size: 2529 bases) GC AT G C A T
Base content (bases) 1049 1480 583 466 598 882
Base content per 1 kb (bases) 415 585 231 184 236 349
Base content (%) 41.5% 58.5%
12S rRNA gene (size: 959 bases) GC AT G C A T
Base content (bases) 414 545 232 182 216 329
Base content per 1 kb (bases) 432 568 242 190 225 343
Base content (%) 43.2% 56.8%
16S rRNA gene (size: 1570 bases) GC AT G C A T
Base content (bases) 635 935 351 284 382 553
Base content per 1 kb (bases) 404 596 224 181 243 352
Base content (%) 40.4% 59.6%

ATP6 (size: 679 bases) GC AT G C A T
Base content (bases) 294 385 200 94 199 186
Base content per 1 kb (bases) 433 567 295 138 293 274
Base content (%) 43.3% 56.7%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 74 130 60 14 63 67
Base content per 1 kb (bases) 363 637 294 69 309 328
Base content (%) 36.3% 63.7%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 704 838 425 279 449 389
Base content per 1 kb (bases) 457 543 276 181 291 252
Base content (%) 45.7% 54.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 279 405 179 100 190 215
Base content per 1 kb (bases) 408 592 262 146 278 314
Base content (%) 40.8% 59.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 360 424 226 134 225 199
Base content per 1 kb (bases) 459 541 288 171 287 254
Base content (%) 45.9% 54.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 527 613 374 153 296 317
Base content per 1 kb (bases) 462 538 328 134 260 278
Base content (%) 46.2% 53.8%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 413 542 288 125 267 275
Base content per 1 kb (bases) 432 568 302 131 280 288
Base content (%) 43.2% 56.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 428 614 322 106 281 333
Base content per 1 kb (bases) 411 589 309 102 270 320
Base content (%) 41.1% 58.9%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 151 196 105 46 94 102
Base content per 1 kb (bases) 435 565 303 133 271 294
Base content (%) 43.5% 56.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 581 797 419 162 392 405
Base content per 1 kb (bases) 422 578 304 118 284 294
Base content (%) 42.2% 57.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 87 39 95 76
Base content per 1 kb (bases) 424 576 293 131 320 256
Base content (%) 42.4% 57.6%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 805 1007 563 242 485 522
Base content per 1 kb (bases) 444 556 311 134 268 288
Base content (%) 44.4% 55.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 230 298 181 49 92 206
Base content per 1 kb (bases) 436 564 343 93 174 390
Base content (%) 43.6% 56.4%

ATP6 (size: 679 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.89%)
Alanine (Ala, A)
n = 18 (8.0%)
Serine (Ser, S)
n = 14 (6.22%)
Threonine (Thr, T)
n = 22 (9.78%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.33%)
Leucine (Leu, L)
n = 45 (20.0%)
Isoleucine (Ile, I)
n = 26 (11.56%)
Methionine (Met, M)
n = 11 (4.89%)
Proline (Pro, P)
n = 13 (5.78%)
Phenylalanine (Phe, F)
n = 10 (4.44%)
Tyrosine (Tyr, Y)
n = 5 (2.22%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.89%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 9 (4.0%)
Glutamine (Gln, Q)
n = 8 (3.56%)
Histidine (His, H)
n = 4 (1.78%)
Lysine (Lys, K)
n = 4 (1.78%)
Arginine (Arg, R)
n = 6 (2.67%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 15 7 7 5 14 7 8 6 2 4 2 4 2 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 7 6 0 1 6 3 1 3 4 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 1 3 3 5 0 1 2 3 2 0 4 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 0 2 2 2 2 2 2 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 64 75 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 64 35 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 72 76 53
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTTTWFVTIVSMYVTLFILFQIKLSNFTYPLNMTPISPSTSNFTTPWETKWTKTYLPLSLPLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (8.96%)
Threonine (Thr, T)
n = 13 (19.4%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (4.48%)
Leucine (Leu, L)
n = 9 (13.43%)
Isoleucine (Ile, I)
n = 4 (5.97%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 5 (7.46%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 1 (1.49%)
Asparagine (Asn, N)
n = 3 (4.48%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (4.48%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 1 1 0 6 0 1 3 0 2 1 0 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 4 3 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 2 2 1 2 0 0 1 2 1 0 1 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 1 0 3 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 17 27 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 25 15 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 18 25 20
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.16%)
Alanine (Ala, A)
n = 40 (7.8%)
Serine (Ser, S)
n = 32 (6.24%)
Threonine (Thr, T)
n = 37 (7.21%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.8%)
Leucine (Leu, L)
n = 61 (11.89%)
Isoleucine (Ile, I)
n = 37 (7.21%)
Methionine (Met, M)
n = 30 (5.85%)
Proline (Pro, P)
n = 27 (5.26%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.73%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 18 (3.51%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 22 18 8 11 26 11 5 6 1 10 14 11 5 13 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 9 25 4 2 12 12 16 7 8 8 10 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 16 4 10 4 12 3 0 3 7 12 1 0 7 11 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 7 7 8 1 2 1 4 1 0 0 0 1 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 115 134 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 177 160 125
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 35 (15.42%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 11 2 7 12 5 6 5 2 4 2 4 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 3 4 2 0 2 2 2 2 2 3 9 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 2 2 7 7 0 1 3 5 5 0 3 1 4 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 13 1 6 7 4 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 61 64 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 62 90 55
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 17 (6.54%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 6 6 6 11 4 2 7 1 1 4 10 2 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 8 4 1 5 8 5 3 1 4 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 9 2 5 6 5 2 1 2 7 5 2 2 0 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 3 2 1 3 0 1 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 68 56 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 92 86 58
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 27 (7.12%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 16 (4.22%)
Leucine (Leu, L)
n = 66 (17.41%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 23 (6.07%)
Tyrosine (Tyr, Y)
n = 17 (4.49%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 27 6 7 17 32 1 6 5 1 1 8 7 0 6 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 2 11 7 1 3 9 9 4 3 6 12 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 10 1 2 9 13 0 0 3 3 14 1 3 2 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 2 1 11 9 0 2 1 4 1 0 1 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 107 104 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 95 78 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 172 135 53
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.47%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 23 (7.26%)
Cysteine (Cys, C)
n = 3 (0.95%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 26 (8.2%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 23 (7.26%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 8 (2.52%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 12 17 6 8 33 4 4 5 1 4 3 5 2 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 5 15 7 1 1 4 3 3 4 5 12 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 5 0 3 5 10 1 1 2 7 5 2 1 4 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 1 2 7 1 1 1 4 2 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 92 91 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 93 56 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 103 128 63
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 34 (9.83%)
Threonine (Thr, T)
n = 29 (8.38%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 68 (19.65%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 35 (10.12%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 21 (6.07%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 2 (0.58%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 31 26 7 15 31 7 6 7 1 1 0 4 1 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 0 4 8 7 0 2 4 9 0 4 8 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 4 2 4 12 13 1 0 4 4 7 3 2 7 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 0 2 9 1 1 1 1 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 93 137 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 98 59 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 131 137 52
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 34 (9.83%)
Threonine (Thr, T)
n = 29 (8.38%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 68 (19.65%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 35 (10.12%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 11 (3.18%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 21 (6.07%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 2 (0.58%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 31 26 7 15 31 7 6 7 1 1 0 4 1 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 0 4 8 7 0 2 4 9 0 4 8 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 4 2 4 12 13 1 0 4 4 7 3 2 7 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 0 2 9 1 1 1 1 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 93 137 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 98 59 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 131 137 52
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 45 (9.83%)
Methionine (Met, M)
n = 33 (7.21%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 22 24 14 21 37 8 9 11 2 7 2 4 0 8 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 2 5 18 6 1 4 7 7 1 4 8 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 13 0 8 4 17 1 2 8 7 6 2 3 3 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 0 4 10 1 1 1 5 3 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 138 156 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 123 78 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 158 171 98
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 2 (2.04%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 8 4 5 11 2 2 2 0 1 1 1 2 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 2 2 2 1 1 2 2 0 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 1 6 3 0 0 0 1 2 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 31 23 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 21 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 35 36 20
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.14%)
Alanine (Ala, A)
n = 47 (7.79%)
Serine (Ser, S)
n = 49 (8.13%)
Threonine (Thr, T)
n = 55 (9.12%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 21 (3.48%)
Leucine (Leu, L)
n = 93 (15.42%)
Isoleucine (Ile, I)
n = 52 (8.62%)
Methionine (Met, M)
n = 35 (5.8%)
Proline (Pro, P)
n = 28 (4.64%)
Phenylalanine (Phe, F)
n = 45 (7.46%)
Tyrosine (Tyr, Y)
n = 19 (3.15%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 24 (3.98%)
Glutamine (Gln, Q)
n = 15 (2.49%)
Histidine (His, H)
n = 21 (3.48%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 36 26 12 21 38 11 10 12 3 4 6 8 3 15 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 2 13 23 7 4 5 13 10 3 3 7 15 3 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 19 3 6 12 18 1 4 8 6 13 2 1 6 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
19 7 4 4 7 17 4 2 3 2 2 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
121 155 199 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 167 123 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 241 200 110
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (18.29%)
Alanine (Ala, A)
n = 3 (1.71%)
Serine (Ser, S)
n = 14 (8.0%)
Threonine (Thr, T)
n = 6 (3.43%)
Cysteine (Cys, C)
n = 3 (1.71%)
Valine (Val, V)
n = 27 (15.43%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 8 (4.57%)
Methionine (Met, M)
n = 13 (7.43%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 11 (6.29%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 10 (5.71%)
Asparagine (Asn, N)
n = 2 (1.14%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.57%)
Arginine (Arg, R)
n = 4 (2.29%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 1 5 2 0 1 4 7 0 0 14 4 2 7 9 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 3 0 2 0 0 1 11 1 9 11 2 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 5 0 1 2 5 1 4 5 2 7 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 10 4 0 0 1 3 0 0 1 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 14 36 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 20 27 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 15 29 76
Total protein-coding genes (size: 11392 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 228 (6.01%)
Alanine (Ala, A)
n = 251 (6.62%)
Serine (Ser, S)
n = 295 (7.78%)
Threonine (Thr, T)
n = 300 (7.91%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 186 (4.9%)
Leucine (Leu, L)
n = 627 (16.53%)
Isoleucine (Ile, I)
n = 325 (8.57%)
Methionine (Met, M)
n = 228 (6.01%)
Proline (Pro, P)
n = 200 (5.27%)
Phenylalanine (Phe, F)
n = 229 (6.04%)
Tyrosine (Tyr, Y)
n = 137 (3.61%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 72 (1.9%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 140 (3.69%)
Glutamine (Gln, Q)
n = 86 (2.27%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 70 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
137 188 161 78 122 262 68 70 72 14 53 47 61 25 80 149
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
67 12 16 56 127 56 12 47 70 75 36 39 59 92 10 64
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
120 96 20 51 70 108 12 15 39 57 80 15 27 38 102 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 67 28 27 45 75 11 15 13 32 10 0 1 4 2 89
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
832 987 1134 842
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
485 992 723 1595
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
358 1318 1320 799

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.