Viewing data for Coccothraustes coccothraustes


Scientific name Coccothraustes coccothraustes
Common name Hawfinch
Maximum lifespan 12.60 years (Coccothraustes coccothraustes@AnAge)

Total mtDNA (size: 16823 bases) GC AT G C A T
Base content (bases) 7601 9219 5202 2399 4022 5197
Base content per 1 kb (bases) 452 548 309 143 239 309
Base content (%) 45.2% 54.8%
Total protein-coding genes (size: 11384 bases) GC AT G C A T
Base content (bases) 5247 6134 3791 1456 2719 3415
Base content per 1 kb (bases) 461 539 333 128 239 300
Base content (%) 46.1% 53.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1544 bases) GC AT G C A T
Base content (bases) 634 910 370 264 392 518
Base content per 1 kb (bases) 411 589 240 171 254 335
Base content (%) 41.1% 58.9%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1166 1406 651 515 552 854
Base content per 1 kb (bases) 453 547 253 200 215 332
Base content (%) 45.3% 54.7%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 463 509 261 202 207 302
Base content per 1 kb (bases) 476 524 269 208 213 311
Base content (%) 47.6% 52.4%
16S rRNA gene (size: 1600 bases) GC AT G C A T
Base content (bases) 703 897 390 313 345 552
Base content per 1 kb (bases) 439 561 244 196 216 345
Base content (%) 43.9% 56.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 301 383 231 70 174 209
Base content per 1 kb (bases) 440 560 338 102 254 306
Base content (%) 44.0% 56.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 73 95 60 13 44 51
Base content per 1 kb (bases) 435 565 357 77 262 304
Base content (%) 43.5% 56.5%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 743 814 485 258 380 434
Base content per 1 kb (bases) 477 523 311 166 244 279
Base content (%) 47.7% 52.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 320 364 221 99 154 210
Base content per 1 kb (bases) 468 532 323 145 225 307
Base content (%) 46.8% 53.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 377 407 254 123 189 218
Base content per 1 kb (bases) 481 519 324 157 241 278
Base content (%) 48.1% 51.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 528 615 377 151 281 334
Base content per 1 kb (bases) 462 538 330 132 246 292
Base content (%) 46.2% 53.8%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 448 530 309 139 263 267
Base content per 1 kb (bases) 458 542 316 142 269 273
Base content (%) 45.8% 54.2%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 463 577 358 105 255 322
Base content per 1 kb (bases) 445 555 344 101 245 310
Base content (%) 44.5% 55.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 158 193 115 43 92 101
Base content per 1 kb (bases) 450 550 328 123 262 288
Base content (%) 45.0% 55.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 625 753 471 154 324 429
Base content per 1 kb (bases) 454 546 342 112 235 311
Base content (%) 45.4% 54.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 147 150 107 40 73 77
Base content per 1 kb (bases) 495 505 360 135 246 259
Base content (%) 49.5% 50.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 810 1008 604 206 438 570
Base content per 1 kb (bases) 446 554 332 113 241 314
Base content (%) 44.6% 55.4%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 259 257 202 57 56 201
Base content per 1 kb (bases) 499 495 389 110 108 387
Base content (%) 49.9% 49.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 7 4 13 34 3 7 8 0 1 1 4 2 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 10 3 0 2 3 3 0 1 4 9 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 1 1 5 6 0 1 3 0 3 0 0 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 0 3 4 0 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 85 67 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 81 107 29
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIITWLTFSLIIQPKLLSFVSMNPPSNKPPIPPTTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 12 (21.82%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 1 0 2 0 2 1 2 0 0 0 0 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 0 0 0 0 0 0 2 3 7 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 1 1 2 0 0 0 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 1 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 18 21 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 24 8 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 18 22 10
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.07%)
Alanine (Ala, A)
n = 46 (8.88%)
Serine (Ser, S)
n = 28 (5.41%)
Threonine (Thr, T)
n = 38 (7.34%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.72%)
Leucine (Leu, L)
n = 63 (12.16%)
Isoleucine (Ile, I)
n = 39 (7.53%)
Methionine (Met, M)
n = 22 (4.25%)
Proline (Pro, P)
n = 30 (5.79%)
Phenylalanine (Phe, F)
n = 43 (8.3%)
Tyrosine (Tyr, Y)
n = 17 (3.28%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 16 (3.09%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 10 (1.93%)
Histidine (His, H)
n = 19 (3.67%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 31 16 6 10 33 8 6 10 0 4 12 21 3 8 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 5 26 15 0 11 9 24 3 6 9 15 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 0 2 12 10 0 0 4 2 15 0 0 2 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 10 0 2 14 9 0 0 2 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 124 128 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 96 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 223 210 65
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 23 (10.13%)
Threonine (Thr, T)
n = 14 (6.17%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 17 (7.49%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 12 11 3 7 15 1 4 6 0 2 7 8 0 0 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 10 4 0 1 1 6 0 2 5 4 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 1 2 8 7 0 0 6 4 3 0 0 0 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 0 1 12 4 0 0 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 59 57 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 59 58 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 103 95 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 25 (9.62%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 5 (1.92%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 12 5 3 5 17 3 5 5 2 2 3 10 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 14 6 0 2 4 12 1 2 3 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 0 3 7 4 0 0 4 1 10 0 0 1 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 1 0 4 5 0 1 0 4 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 70 54 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 71 55 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 113 109 29
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 20 (5.26%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 26 (6.84%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 25 5 5 10 38 3 7 8 0 3 10 12 1 1 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 4 18 7 0 2 7 14 1 6 8 9 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 0 2 5 12 0 0 1 2 10 0 0 1 19 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 3 6 10 0 1 2 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 108 96 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 98 79 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 171 159 43
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 28 (8.62%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 20 (6.15%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 65 (20.0%)
Isoleucine (Ile, I)
n = 22 (6.77%)
Methionine (Met, M)
n = 12 (3.69%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 20 (6.15%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 13 (4.0%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 8 (2.46%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 13 6 9 14 30 2 8 4 2 1 6 9 1 4 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 4 11 12 1 1 4 6 2 5 9 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 2 5 6 7 2 0 6 4 10 3 2 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 1 3 6 2 1 1 6 0 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 96 82 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 93 58 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 120 127 52
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 41 (11.88%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 32 (9.28%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 26 16 8 12 37 3 6 8 2 1 7 1 1 0 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 7 10 9 1 5 2 4 1 4 7 8 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 13 1 6 11 11 0 0 7 3 4 0 0 1 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 0 1 13 1 0 2 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 104 123 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 117 57 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 137 141 52
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 41 (11.88%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 32 (9.28%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 26 16 8 12 37 3 6 8 2 1 7 1 1 0 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 7 10 9 1 5 2 4 1 4 7 8 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 13 1 6 11 11 0 0 7 3 4 0 0 1 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 0 1 13 1 0 2 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 104 123 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 117 57 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 137 141 52
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 42 (9.17%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 42 (9.17%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 26 (5.68%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 31 19 8 18 54 6 11 14 0 1 4 6 1 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 5 25 12 0 2 9 6 0 4 10 12 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 21 0 5 7 13 1 2 7 2 10 1 1 1 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 0 2 7 3 0 2 9 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 153 143 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 136 81 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 182 205 53
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 5 1 0 16 2 0 3 0 0 1 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 0 7 2 0 0 4 0 0 1 0 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 1 3 5 2 0 0 3 1 2 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 0 2 0 1 0 0 0 0 1 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 33 24 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 45 35 11
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 48 (7.93%)
Serine (Ser, S)
n = 49 (8.1%)
Threonine (Thr, T)
n = 71 (11.74%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 101 (16.69%)
Isoleucine (Ile, I)
n = 55 (9.09%)
Methionine (Met, M)
n = 30 (4.96%)
Proline (Pro, P)
n = 27 (4.46%)
Phenylalanine (Phe, F)
n = 39 (6.45%)
Tyrosine (Tyr, Y)
n = 14 (2.31%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 28 (4.63%)
Glutamine (Gln, Q)
n = 16 (2.64%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 41 25 11 21 57 5 7 14 2 2 5 9 0 4 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 3 6 26 16 0 4 9 18 2 8 7 11 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
37 24 1 3 20 16 1 1 8 4 10 1 0 2 26 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 1 4 4 19 1 0 1 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
117 157 214 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 186 110 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 261 246 79
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.28%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 35 (20.35%)
Leucine (Leu, L)
n = 31 (18.02%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 8 (4.65%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 1 4 0 0 4 8 0 0 13 1 5 16 7 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 5 0 2 5 6 2 1 19 2 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 6 1 2 2 3 1 5 2 4 15 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 4 0 0 0 1 0 0 3 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 16 16 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 29 19 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
76 12 21 62
Total protein-coding genes (size: 11401 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 218 (5.74%)
Alanine (Ala, A)
n = 306 (8.06%)
Serine (Ser, S)
n = 291 (7.66%)
Threonine (Thr, T)
n = 318 (8.37%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 200 (5.27%)
Leucine (Leu, L)
n = 665 (17.51%)
Isoleucine (Ile, I)
n = 287 (7.56%)
Methionine (Met, M)
n = 164 (4.32%)
Proline (Pro, P)
n = 219 (5.77%)
Phenylalanine (Phe, F)
n = 225 (5.92%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 134 (3.53%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 87 (2.29%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
71 216 121 64 119 348 43 72 85 8 30 57 87 26 39 186
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 7 22 47 162 90 7 36 56 97 29 43 68 102 6 56
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
128 127 7 40 93 94 6 7 51 28 81 9 19 15 119 20
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
84 80 12 15 53 79 8 4 16 46 6 2 1 5 2 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
884 1062 1051 800
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
486 1076 694 1541
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
232 1511 1532 522

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.