Viewing data for Agelaius phoeniceus


Scientific name Agelaius phoeniceus
Common name Red-winged blackbird
Maximum lifespan 20.00 years (Agelaius phoeniceus@AnAge)

Total mtDNA (size: 16775 bases) GC AT G C A T
Base content (bases) 7701 9074 5330 2371 3983 5091
Base content per 1 kb (bases) 459 541 318 141 237 303
Base content (%) 45.9% 54.1%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5335 6043 3897 1438 2691 3352
Base content per 1 kb (bases) 469 531 343 126 237 295
Base content (%) 46.9% 53.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1538 bases) GC AT G C A T
Base content (bases) 643 895 376 267 392 503
Base content per 1 kb (bases) 418 582 244 174 255 327
Base content (%) 41.8% 58.2%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1180 1392 665 515 537 855
Base content per 1 kb (bases) 459 541 259 200 209 332
Base content (%) 45.9% 54.1%
12S rRNA gene (size: 974 bases) GC AT G C A T
Base content (bases) 472 502 269 203 198 304
Base content per 1 kb (bases) 485 515 276 208 203 312
Base content (%) 48.5% 51.5%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 708 890 396 312 339 551
Base content per 1 kb (bases) 443 557 248 195 212 345
Base content (%) 44.3% 55.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 315 369 240 75 171 198
Base content per 1 kb (bases) 461 539 351 110 250 289
Base content (%) 46.1% 53.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 62 14 46 46
Base content per 1 kb (bases) 452 548 369 83 274 274
Base content (%) 45.2% 54.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 722 829 469 253 388 441
Base content per 1 kb (bases) 466 534 302 163 250 284
Base content (%) 46.6% 53.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 331 353 230 101 149 204
Base content per 1 kb (bases) 484 516 336 148 218 298
Base content (%) 48.4% 51.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 377 407 259 118 192 215
Base content per 1 kb (bases) 481 519 330 151 245 274
Base content (%) 48.1% 51.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 535 608 385 150 291 317
Base content per 1 kb (bases) 468 532 337 131 255 277
Base content (%) 46.8% 53.2%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 456 522 319 137 264 258
Base content per 1 kb (bases) 466 534 326 140 270 264
Base content (%) 46.6% 53.4%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 477 563 369 108 252 311
Base content per 1 kb (bases) 459 541 355 104 242 299
Base content (%) 45.9% 54.1%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 164 187 121 43 87 100
Base content per 1 kb (bases) 467 533 345 123 248 285
Base content (%) 46.7% 53.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 645 733 494 151 315 418
Base content per 1 kb (bases) 468 532 358 110 229 303
Base content (%) 46.8% 53.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 145 152 109 36 72 80
Base content per 1 kb (bases) 488 512 367 121 242 269
Base content (%) 48.8% 51.2%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 837 981 632 205 408 573
Base content per 1 kb (bases) 460 540 348 113 224 315
Base content (%) 46.0% 54.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 260 259 211 49 60 199
Base content per 1 kb (bases) 501 499 407 94 116 383
Base content (%) 50.1% 49.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 12 7 8 15 24 5 5 6 2 1 4 4 1 1 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 11 4 0 1 3 3 1 1 3 11 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 16 0 3 5 3 1 0 4 1 2 0 2 1 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 3 4 0 0 2 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 83 65 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 92 98 24
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFFIMLTSWLTFSLIIQPKLLSFVSMNPPSNKPPVAPTTTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 1 2 1 3 0 0 1 1 0 1 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 2 0 0 0 0 0 0 1 6 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 0 2 0 2 1 0 1 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 19 18 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 24 8 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 19 20 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.95%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 32 18 7 9 40 2 4 9 0 9 10 20 2 9 34
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 22 18 1 6 15 25 1 8 5 17 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 18 2 2 11 11 0 0 4 2 15 0 1 3 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 1 3 12 9 0 1 1 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 124 126 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 94 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 207 221 74
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 12 7 3 6 18 3 1 6 0 1 11 5 1 0 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 0 12 5 0 2 2 4 0 5 1 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 6 0 2 6 8 0 1 4 1 6 0 0 1 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 1 3 9 4 0 1 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 63 57 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 61 58 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 106 89 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 10 6 2 9 18 0 4 7 1 3 6 7 0 5 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 15 5 0 0 7 11 1 3 5 4 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 3 4 7 0 0 4 1 10 0 0 0 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 1 3 4 0 0 2 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 71 54 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 118 106 32
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 24 (6.32%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 23 (6.05%)
Leucine (Leu, L)
n = 68 (17.89%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 23 (6.05%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 21 6 9 18 36 3 2 8 0 4 12 7 0 4 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 4 21 3 1 1 10 12 1 3 4 16 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 2 2 5 14 0 0 1 2 10 0 0 5 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 2 0 9 10 0 2 1 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 117 94 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 97 79 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 171 144 56
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 24 (7.38%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 15 (4.62%)
Leucine (Leu, L)
n = 67 (20.62%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 10 (3.08%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 16 8 11 13 23 7 12 5 1 1 6 6 2 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 14 9 3 2 4 6 2 3 10 12 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 4 11 4 0 0 5 4 12 0 1 4 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 1 3 5 2 2 2 4 0 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 95 80 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 93 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 131 118 53
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 31 (8.99%)
Serine (Ser, S)
n = 26 (7.54%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 30 14 10 20 25 7 5 7 3 1 2 2 2 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 6 12 13 0 1 6 4 1 5 6 11 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 12 2 6 11 4 0 2 3 1 6 1 0 3 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 0 1 12 1 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 107 126 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 118 58 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 144 126 57
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 31 (8.99%)
Serine (Ser, S)
n = 26 (7.54%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 67 (19.42%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 30 14 10 20 25 7 5 7 3 1 2 2 2 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 6 12 13 0 1 6 4 1 5 6 11 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 12 2 6 11 4 0 2 3 1 6 1 0 3 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 0 1 12 1 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 107 126 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 118 58 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 144 126 57
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.49%)
Alanine (Ala, A)
n = 42 (9.17%)
Serine (Ser, S)
n = 44 (9.61%)
Threonine (Thr, T)
n = 37 (8.08%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 24 (5.24%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 10 (2.18%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 34 17 10 26 46 3 12 13 1 2 4 5 0 0 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 8 23 10 1 1 7 8 0 2 12 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 2 3 14 16 0 1 10 2 12 1 0 2 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 0 2 10 0 1 3 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 152 142 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 140 80 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 202 196 45
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 4 0 3 15 0 2 3 0 0 1 2 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 0 8 2 0 0 3 1 0 1 1 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 0 2 4 4 0 0 4 0 3 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 0 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 31 23 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 49 39 9
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 48 (7.93%)
Serine (Ser, S)
n = 46 (7.6%)
Threonine (Thr, T)
n = 73 (12.07%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 107 (17.69%)
Isoleucine (Ile, I)
n = 55 (9.09%)
Methionine (Met, M)
n = 25 (4.13%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 35 (5.79%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 28 (4.63%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 41 23 10 25 57 8 7 16 1 1 4 11 1 4 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 5 6 26 15 1 1 11 19 2 5 13 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
36 28 1 4 20 13 0 0 9 1 11 0 0 3 25 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 12 0 0 9 21 0 1 2 5 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
119 166 212 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 188 110 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 278 251 60
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.02%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 14 (8.14%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 35 (20.35%)
Leucine (Leu, L)
n = 32 (18.6%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 7 (4.07%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.49%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 1 4 1 1 1 8 0 0 16 0 3 16 7 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 2 2 3 5 7 0 5 19 3 0 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 0 1 4 4 0 6 1 1 17 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 1 1 0 0 0 0 0 4 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 15 16 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 28 18 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
80 6 26 61
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.82%)
Alanine (Ala, A)
n = 314 (8.27%)
Serine (Ser, S)
n = 285 (7.51%)
Threonine (Thr, T)
n = 317 (8.35%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 201 (5.3%)
Leucine (Leu, L)
n = 680 (17.91%)
Isoleucine (Ile, I)
n = 290 (7.64%)
Methionine (Met, M)
n = 149 (3.93%)
Proline (Pro, P)
n = 223 (5.87%)
Phenylalanine (Phe, F)
n = 214 (5.64%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 138 (3.64%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
70 220 117 77 153 327 40 62 85 10 40 61 74 26 40 174
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 6 23 43 171 88 12 23 69 100 29 40 69 110 4 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
128 125 10 39 93 88 7 8 50 21 90 3 21 25 113 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
82 78 14 9 56 82 3 8 18 42 5 1 2 6 1 103
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
893 1087 1040 777
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1081 692 1534
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
219 1570 1488 520

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.