Viewing data for Rattus rattus


Scientific name Rattus rattus
Common name Rat
Maximum lifespan 4.20 years (Rattus rattus@AnAge)

Total mtDNA (size: 16305 bases) GC AT G C A T
Base content (bases) 6212 10093 4162 2050 4547 5546
Base content per 1 kb (bases) 381 619 255 126 279 340
Base content (%) 38.1% 61.9%
Total protein-coding genes (size: 11330 bases) GC AT G C A T
Base content (bases) 4419 6911 3123 1296 3203 3708
Base content per 1 kb (bases) 390 610 276 114 283 327
Base content (%) 39.0% 61.0%
D-loop (size: 898 bases) GC AT G C A T
Base content (bases) 316 582 218 98 266 316
Base content per 1 kb (bases) 352 648 243 109 296 352
Base content (%) 35.2% 64.8%
Total tRNA-coding genes (size: 1496 bases) GC AT G C A T
Base content (bases) 526 970 301 225 424 546
Base content per 1 kb (bases) 352 648 201 150 283 365
Base content (%) 35.2% 64.8%
Total rRNA-coding genes (size: 2525 bases) GC AT G C A T
Base content (bases) 926 1599 506 420 638 961
Base content per 1 kb (bases) 367 633 200 166 253 381
Base content (%) 36.7% 63.3%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 366 590 203 163 238 352
Base content per 1 kb (bases) 383 617 212 171 249 368
Base content (%) 38.3% 61.7%
16S rRNA gene (size: 1569 bases) GC AT G C A T
Base content (bases) 560 1009 303 257 400 609
Base content per 1 kb (bases) 357 643 193 164 255 388
Base content (%) 35.7% 64.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 258 423 184 74 206 217
Base content per 1 kb (bases) 379 621 270 109 302 319
Base content (%) 37.9% 62.1%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 71 133 58 13 56 77
Base content per 1 kb (bases) 348 652 284 64 275 377
Base content (%) 34.8% 65.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 640 905 384 256 476 429
Base content per 1 kb (bases) 414 586 249 166 308 278
Base content (%) 41.4% 58.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 270 414 179 91 181 233
Base content per 1 kb (bases) 395 605 262 133 265 341
Base content (%) 39.5% 60.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 318 466 211 107 226 240
Base content per 1 kb (bases) 406 594 269 136 288 306
Base content (%) 40.6% 59.4%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 459 684 319 140 327 357
Base content per 1 kb (bases) 402 598 279 122 286 312
Base content (%) 40.2% 59.8%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 410 545 294 116 257 288
Base content per 1 kb (bases) 429 571 308 121 269 302
Base content (%) 42.9% 57.1%
ND2 (size: 1036 bases) GC AT G C A T
Base content (bases) 391 645 304 87 274 371
Base content per 1 kb (bases) 377 623 293 84 264 358
Base content (%) 37.7% 62.3%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 138 210 99 39 102 108
Base content per 1 kb (bases) 397 603 284 112 293 310
Base content (%) 39.7% 60.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 521 857 381 140 381 476
Base content per 1 kb (bases) 378 622 276 102 276 345
Base content (%) 37.8% 62.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 111 186 81 30 95 91
Base content per 1 kb (bases) 374 626 273 101 320 306
Base content (%) 37.4% 62.6%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 681 1149 504 177 532 617
Base content per 1 kb (bases) 372 628 275 97 291 337
Base content (%) 37.2% 62.8%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 175 344 141 34 113 231
Base content per 1 kb (bases) 337 663 272 66 218 445
Base content (%) 33.7% 66.3%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 28 (12.39%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 6 (2.65%)
Histidine (His, H)
n = 9 (3.98%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 11 11 9 5 18 0 8 6 0 1 1 8 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 5 5 6 0 2 3 5 0 2 4 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 1 3 0 6 0 1 5 1 1 0 2 4 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 1 0 3 2 0 2 2 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 66 82 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 60 36 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 58 99 61
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIISSMITLFILFQLKISSQTFPTAPSPKIMATEKTSNPWESKWTKIYLPLSLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.99%)
Serine (Ser, S)
n = 9 (13.43%)
Threonine (Thr, T)
n = 9 (13.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (10.45%)
Isoleucine (Ile, I)
n = 8 (11.94%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 1 (1.49%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (7.46%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 4 2 1 0 2 0 3 4 1 0 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 2 0 0 0 0 0 0 3 3 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 1 1 3 4 0 0 1 1 0 0 1 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 15 27 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 26 16 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 17 34 13
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 42 (8.17%)
Serine (Ser, S)
n = 35 (6.81%)
Threonine (Thr, T)
n = 35 (6.81%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.78%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 36 (7.0%)
Methionine (Met, M)
n = 30 (5.84%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 20 (3.89%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 16 24 12 12 21 1 11 5 1 6 7 22 5 22 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 11 20 11 0 6 8 26 6 13 3 11 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 19 1 11 7 14 0 1 2 10 10 2 2 6 10 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 2 12 4 9 1 1 0 7 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 106 130 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 137 96 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 141 203 143
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 11 13 7 2 16 0 7 6 0 3 2 5 4 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 5 3 1 0 2 4 1 1 3 2 9 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 11 0 2 4 8 0 1 3 2 7 1 0 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 1 2 9 5 0 3 0 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 58 68 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 53 62 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 68 103 48
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 10 (3.85%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 7 6 4 20 0 4 7 0 4 2 8 0 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 3 9 0 3 6 11 1 2 4 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 0 3 3 12 0 0 3 6 6 0 1 3 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 1 3 3 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 69 62 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 63 58 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 79 120 58
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 23 (6.05%)
Serine (Ser, S)
n = 24 (6.32%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 55 (14.47%)
Isoleucine (Ile, I)
n = 44 (11.58%)
Methionine (Met, M)
n = 12 (3.16%)
Proline (Pro, P)
n = 22 (5.79%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 12 (3.16%)
Aspartic acid (Asp, D)
n = 11 (2.89%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.47%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.42%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 20 10 6 8 25 0 16 6 0 2 3 13 0 10 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 11 10 0 1 7 14 3 2 4 16 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 14 0 2 7 13 0 2 0 2 13 1 0 3 14 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 0 11 9 1 1 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 88 110 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 92 79 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 139 168 67
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 25 (7.89%)
Serine (Ser, S)
n = 27 (8.52%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 12 (3.79%)
Leucine (Leu, L)
n = 57 (17.98%)
Isoleucine (Ile, I)
n = 28 (8.83%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 15 (4.73%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 12 (3.79%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 6 (1.89%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 15 17 2 10 32 4 8 6 0 2 4 4 2 8 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 1 16 7 1 2 4 6 0 5 6 9 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 1 9 12 1 1 3 3 12 1 1 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 1 1 2 5 1 0 3 4 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 89 90 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 91 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 114 139 47
ND2 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.78%)
Alanine (Ala, A)
n = 21 (6.1%)
Serine (Ser, S)
n = 32 (9.3%)
Threonine (Thr, T)
n = 35 (10.17%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 63 (18.31%)
Isoleucine (Ile, I)
n = 37 (10.76%)
Methionine (Met, M)
n = 27 (7.85%)
Proline (Pro, P)
n = 20 (5.81%)
Phenylalanine (Phe, F)
n = 12 (3.49%)
Tyrosine (Tyr, Y)
n = 11 (3.2%)
Tryptophan (Trp, W)
n = 8 (2.33%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 21 (6.1%)
Glutamine (Gln, Q)
n = 12 (3.49%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 12 (3.49%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 21 23 5 15 30 1 12 12 0 0 3 2 1 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 4 7 10 0 0 1 9 3 5 5 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 1 3 7 17 0 3 2 5 6 0 0 5 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 1 11 1 0 0 2 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 92 137 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 67 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 109 167 57
ND3 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.78%)
Alanine (Ala, A)
n = 21 (6.1%)
Serine (Ser, S)
n = 32 (9.3%)
Threonine (Thr, T)
n = 35 (10.17%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 63 (18.31%)
Isoleucine (Ile, I)
n = 37 (10.76%)
Methionine (Met, M)
n = 27 (7.85%)
Proline (Pro, P)
n = 20 (5.81%)
Phenylalanine (Phe, F)
n = 12 (3.49%)
Tyrosine (Tyr, Y)
n = 11 (3.2%)
Tryptophan (Trp, W)
n = 8 (2.33%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 21 (6.1%)
Glutamine (Gln, Q)
n = 12 (3.49%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 12 (3.49%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 21 23 5 15 30 1 12 12 0 0 3 2 1 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 4 7 10 0 0 1 9 3 5 5 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 1 3 7 17 0 3 2 5 6 0 0 5 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 1 11 1 0 0 2 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 92 137 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 67 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 109 167 57
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 42 (9.17%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 84 (18.34%)
Isoleucine (Ile, I)
n = 49 (10.7%)
Methionine (Met, M)
n = 40 (8.73%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 26 32 13 13 35 1 20 11 1 2 5 3 0 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 5 9 15 0 3 5 9 0 1 9 13 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 25 0 3 11 14 2 2 10 5 8 0 2 7 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 1 0 4 12 1 1 0 8 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 117 175 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 122 83 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 142 218 82
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 11 (11.22%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 1 (1.02%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 8 1 3 7 2 6 2 0 0 1 3 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 2 3 0 1 1 2 0 0 1 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 4 5 2 0 0 0 2 0 0 0 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 1 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 18 34 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 30 16 45
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 33 41 21
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.11%)
Alanine (Ala, A)
n = 33 (5.42%)
Serine (Ser, S)
n = 54 (8.87%)
Threonine (Thr, T)
n = 59 (9.69%)
Cysteine (Cys, C)
n = 7 (1.15%)
Valine (Val, V)
n = 16 (2.63%)
Leucine (Leu, L)
n = 92 (15.11%)
Isoleucine (Ile, I)
n = 66 (10.84%)
Methionine (Met, M)
n = 40 (6.57%)
Proline (Pro, P)
n = 25 (4.11%)
Phenylalanine (Phe, F)
n = 41 (6.73%)
Tyrosine (Tyr, Y)
n = 19 (3.12%)
Tryptophan (Trp, W)
n = 14 (2.3%)
Aspartic acid (Asp, D)
n = 10 (1.64%)
Glutamic acid (Glu, E)
n = 10 (1.64%)
Asparagine (Asn, N)
n = 39 (6.4%)
Glutamine (Gln, Q)
n = 15 (2.46%)
Histidine (His, H)
n = 11 (1.81%)
Lysine (Lys, K)
n = 24 (3.94%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 33 35 11 20 44 2 14 13 2 4 4 7 1 20 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 7 6 16 11 0 2 6 16 1 4 6 15 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 23 1 10 12 22 0 1 9 7 12 1 1 13 26 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 1 2 8 21 3 3 0 6 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
94 137 238 141
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 161 129 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 206 250 136
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.95%)
Alanine (Ala, A)
n = 7 (4.07%)
Serine (Ser, S)
n = 9 (5.23%)
Threonine (Thr, T)
n = 8 (4.65%)
Cysteine (Cys, C)
n = 4 (2.33%)
Valine (Val, V)
n = 15 (8.72%)
Leucine (Leu, L)
n = 26 (15.12%)
Isoleucine (Ile, I)
n = 13 (7.56%)
Methionine (Met, M)
n = 13 (7.56%)
Proline (Pro, P)
n = 3 (1.74%)
Phenylalanine (Phe, F)
n = 16 (9.3%)
Tyrosine (Tyr, Y)
n = 8 (4.65%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 6 (3.49%)
Glutamic acid (Glu, E)
n = 8 (4.65%)
Asparagine (Asn, N)
n = 4 (2.33%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 1 (0.58%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 1 5 2 0 1 0 12 0 0 7 1 4 3 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 4 0 4 0 2 1 12 1 4 7 2 0 1 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 2 0 2 0 5 0 7 1 3 11 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 5 1 0 2 0 0 0 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 7 45 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 22 29 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 5 39 87
Total protein-coding genes (size: 11404 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 208 (5.48%)
Alanine (Ala, A)
n = 240 (6.32%)
Serine (Ser, S)
n = 304 (8.0%)
Threonine (Thr, T)
n = 312 (8.21%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 161 (4.24%)
Leucine (Leu, L)
n = 591 (15.56%)
Isoleucine (Ile, I)
n = 365 (9.61%)
Methionine (Met, M)
n = 235 (6.19%)
Proline (Pro, P)
n = 196 (5.16%)
Phenylalanine (Phe, F)
n = 237 (6.24%)
Tyrosine (Tyr, Y)
n = 130 (3.42%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 71 (1.87%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 168 (4.42%)
Glutamine (Gln, Q)
n = 86 (2.26%)
Histidine (His, H)
n = 97 (2.55%)
Lysine (Lys, K)
n = 99 (2.61%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
188 177 190 80 98 257 12 123 81 5 32 33 80 16 115 122
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 8 21 51 97 90 2 34 47 104 23 42 50 100 4 55
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
88 163 6 47 69 128 3 17 40 53 77 9 21 56 112 38
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
59 80 13 25 46 87 12 9 11 40 4 0 0 9 0 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
773 890 1236 901
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 995 753 1589
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
175 1147 1628 850

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.