Viewing data for Xenopus laevis


Scientific name Xenopus laevis
Common name African clawed frog
Maximum lifespan 30.30 years (Xenopus laevis@AnAge)

Total mtDNA (size: 17553 bases) GC AT G C A T
Base content (bases) 6492 11061 4123 2369 5259 5802
Base content per 1 kb (bases) 370 630 235 135 300 331
Base content (%) 37.0% 63.0%
Total protein-coding genes (size: 11352 bases) GC AT G C A T
Base content (bases) 4228 7124 2799 1429 3540 3584
Base content per 1 kb (bases) 372 628 247 126 312 316
Base content (%) 37.2% 62.8%
D-loop (size: 2134 bases) GC AT G C A T
Base content (bases) 583 1551 382 201 712 839
Base content per 1 kb (bases) 273 727 179 94 334 393
Base content (%) 27.3% 72.7%
Total tRNA-coding genes (size: 1535 bases) GC AT G C A T
Base content (bases) 653 882 374 279 393 489
Base content per 1 kb (bases) 425 575 244 182 256 319
Base content (%) 42.5% 57.5%
Total rRNA-coding genes (size: 2450 bases) GC AT G C A T
Base content (bases) 1003 1447 552 451 588 859
Base content per 1 kb (bases) 409 591 225 184 240 351
Base content (%) 40.9% 59.1%
12S rRNA gene (size: 819 bases) GC AT G C A T
Base content (bases) 372 447 209 163 181 266
Base content per 1 kb (bases) 454 546 255 199 221 325
Base content (%) 45.4% 54.6%
16S rRNA gene (size: 1631 bases) GC AT G C A T
Base content (bases) 631 1000 343 288 407 593
Base content per 1 kb (bases) 387 613 210 177 250 364
Base content (%) 38.7% 61.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 244 437 173 71 231 206
Base content per 1 kb (bases) 358 642 254 104 339 302
Base content (%) 35.8% 64.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 61 107 47 14 43 64
Base content per 1 kb (bases) 363 637 280 83 256 381
Base content (%) 36.3% 63.7%
COX1 (size: 1555 bases) GC AT G C A T
Base content (bases) 605 950 348 257 506 444
Base content per 1 kb (bases) 389 611 224 165 325 286
Base content (%) 38.9% 61.1%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 269 419 168 101 198 221
Base content per 1 kb (bases) 391 609 244 147 288 321
Base content (%) 39.1% 60.9%
COX3 (size: 781 bases) GC AT G C A T
Base content (bases) 312 469 189 123 236 233
Base content per 1 kb (bases) 399 601 242 157 302 298
Base content (%) 39.9% 60.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 433 707 289 144 371 336
Base content per 1 kb (bases) 380 620 254 126 325 295
Base content (%) 38.0% 62.0%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 362 610 242 120 303 307
Base content per 1 kb (bases) 372 628 249 123 312 316
Base content (%) 37.2% 62.8%
ND2 (size: 1038 bases) GC AT G C A T
Base content (bases) 385 653 279 106 323 330
Base content per 1 kb (bases) 371 629 269 102 311 318
Base content (%) 37.1% 62.9%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 137 206 90 47 116 90
Base content per 1 kb (bases) 399 601 262 137 338 262
Base content (%) 39.9% 60.1%
ND4 (size: 1384 bases) GC AT G C A T
Base content (bases) 494 890 340 154 438 452
Base content per 1 kb (bases) 357 643 246 111 316 327
Base content (%) 35.7% 64.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 109 188 71 38 98 90
Base content per 1 kb (bases) 367 633 239 128 330 303
Base content (%) 36.7% 63.3%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 630 1185 422 208 582 603
Base content per 1 kb (bases) 347 653 233 115 321 332
Base content (%) 34.7% 65.3%
ND6 (size: 513 bases) GC AT G C A T
Base content (bases) 192 321 144 48 102 219
Base content per 1 kb (bases) 374 626 281 94 199 427
Base content (%) 37.4% 62.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 52 (23.01%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 9 (3.98%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 4 (1.77%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 9 6 14 2 14 0 20 8 0 5 3 4 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 5 5 7 0 2 2 5 0 4 2 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 11 0 2 2 5 1 0 4 2 3 0 2 4 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 1 1 1 1 0 0 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 60 68 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 63 36 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 50 102 68
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPGPWFLILIFSWLVLLTFIPPKVLKHKAFNEPTTQTTEKSKPNPWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 0 2 0 2 0 3 1 1 1 1 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 2 0 7 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 1 1 0 0 0 0 0 0 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 0 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 16 19 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 18 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 13 30 11
COX1 (size: 1555 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.9%)
Alanine (Ala, A)
n = 43 (8.32%)
Serine (Ser, S)
n = 30 (5.8%)
Threonine (Thr, T)
n = 42 (8.12%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.77%)
Leucine (Leu, L)
n = 64 (12.38%)
Isoleucine (Ile, I)
n = 41 (7.93%)
Methionine (Met, M)
n = 31 (6.0%)
Proline (Pro, P)
n = 26 (5.03%)
Phenylalanine (Phe, F)
n = 38 (7.35%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 10 (1.93%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 15 25 21 2 10 2 26 8 1 14 5 13 3 20 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 15 10 17 1 11 8 19 8 9 3 11 3 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 22 1 8 3 13 0 0 6 7 12 1 3 8 7 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 1 7 8 9 1 2 0 6 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 97 145 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 135 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 116 203 168
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 15 (6.58%)
Serine (Ser, S)
n = 17 (7.46%)
Threonine (Thr, T)
n = 18 (7.89%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.58%)
Leucine (Leu, L)
n = 26 (11.4%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 15 (6.58%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 12 (5.26%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 13 8 4 7 1 5 7 0 6 3 5 1 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 4 8 0 2 1 5 0 1 1 10 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 1 4 2 6 1 1 3 4 4 0 1 4 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 2 5 7 3 0 2 0 3 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 56 66 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 61 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 52 94 71
COX3 (size: 781 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.11%)
Alanine (Ala, A)
n = 20 (7.72%)
Serine (Ser, S)
n = 15 (5.79%)
Threonine (Thr, T)
n = 21 (8.11%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.95%)
Leucine (Leu, L)
n = 32 (12.36%)
Isoleucine (Ile, I)
n = 16 (6.18%)
Methionine (Met, M)
n = 9 (3.47%)
Proline (Pro, P)
n = 12 (4.63%)
Phenylalanine (Phe, F)
n = 22 (8.49%)
Tyrosine (Tyr, Y)
n = 12 (4.63%)
Tryptophan (Trp, W)
n = 12 (4.63%)
Aspartic acid (Asp, D)
n = 5 (1.93%)
Glutamic acid (Glu, E)
n = 9 (3.47%)
Asparagine (Asn, N)
n = 3 (1.16%)
Glutamine (Gln, Q)
n = 8 (3.09%)
Histidine (His, H)
n = 15 (5.79%)
Lysine (Lys, K)
n = 3 (1.16%)
Arginine (Arg, R)
n = 5 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 3 7 12 1 10 0 9 8 0 5 3 9 1 11 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 4 6 10 0 2 5 13 1 2 2 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 11 1 1 0 10 1 0 3 6 6 1 0 0 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 2 3 3 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 63 55 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 55 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 61 123 69
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 35 (9.23%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 32 (8.44%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 10 (2.64%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 13 13 14 10 15 0 20 6 1 4 3 9 2 12 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 7 12 6 0 3 4 16 3 5 1 16 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 9 3 11 0 1 2 5 9 0 1 9 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 3 8 10 0 1 1 5 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 87 104 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 93 79 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 109 153 108
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.88%)
Alanine (Ala, A)
n = 26 (8.05%)
Serine (Ser, S)
n = 27 (8.36%)
Threonine (Thr, T)
n = 24 (7.43%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.72%)
Leucine (Leu, L)
n = 54 (16.72%)
Isoleucine (Ile, I)
n = 31 (9.6%)
Methionine (Met, M)
n = 21 (6.5%)
Proline (Pro, P)
n = 20 (6.19%)
Phenylalanine (Phe, F)
n = 15 (4.64%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.41%)
Asparagine (Asn, N)
n = 10 (3.1%)
Glutamine (Gln, Q)
n = 9 (2.79%)
Histidine (His, H)
n = 4 (1.24%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 10 18 10 9 15 0 19 9 0 5 1 6 0 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 4 7 14 1 3 2 14 0 4 4 10 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 0 5 7 14 0 0 1 6 6 2 1 6 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 2 2 7 0 2 0 6 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 75 94 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 96 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 71 155 87
ND2 (size: 1038 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 26 (7.54%)
Serine (Ser, S)
n = 42 (12.17%)
Threonine (Thr, T)
n = 41 (11.88%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 72 (20.87%)
Isoleucine (Ile, I)
n = 30 (8.7%)
Methionine (Met, M)
n = 11 (3.19%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 5 (1.45%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 12 (3.48%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 10 (2.9%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 11 9 19 10 13 2 27 11 1 1 2 4 0 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 7 7 12 0 3 3 6 2 4 1 14 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 23 2 9 5 19 2 3 4 3 2 1 1 5 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 1 0 10 0 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 86 110 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 121 53 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 72 167 93
ND3 (size: 1038 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 26 (7.54%)
Serine (Ser, S)
n = 42 (12.17%)
Threonine (Thr, T)
n = 41 (11.88%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 72 (20.87%)
Isoleucine (Ile, I)
n = 30 (8.7%)
Methionine (Met, M)
n = 11 (3.19%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 5 (1.45%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 11 (3.19%)
Glutamine (Gln, Q)
n = 12 (3.48%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 10 (2.9%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 11 9 19 10 13 2 27 11 1 1 2 4 0 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 7 7 12 0 3 3 6 2 4 1 14 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 23 2 9 5 19 2 3 4 3 2 1 1 5 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 1 0 10 0 0 1 3 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 86 110 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 121 53 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 72 167 93
ND4 (size: 1384 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.35%)
Alanine (Ala, A)
n = 28 (6.09%)
Serine (Ser, S)
n = 43 (9.35%)
Threonine (Thr, T)
n = 43 (9.35%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 7 (1.52%)
Leucine (Leu, L)
n = 89 (19.35%)
Isoleucine (Ile, I)
n = 43 (9.35%)
Methionine (Met, M)
n = 29 (6.3%)
Proline (Pro, P)
n = 25 (5.43%)
Phenylalanine (Phe, F)
n = 16 (3.48%)
Tyrosine (Tyr, Y)
n = 14 (3.04%)
Tryptophan (Trp, W)
n = 17 (3.7%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 19 (4.13%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 11 (2.39%)
Arginine (Arg, R)
n = 11 (2.39%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 15 24 22 6 19 2 37 12 0 2 1 4 0 12 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 4 10 10 8 0 5 4 10 1 5 2 16 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 20 1 5 9 20 0 2 7 5 9 1 3 11 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 3 2 2 9 2 2 1 8 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 109 154 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 130 85 184
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 101 213 127
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 3 (3.06%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 5 6 4 2 9 0 8 0 0 0 0 0 1 5 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 2 3 0 1 0 5 0 3 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 2 1 2 1 1 3 1 2 0 0 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 2 1 1 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 24 30 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 24 18 43
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 23 42 29
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.8%)
Alanine (Ala, A)
n = 46 (7.62%)
Serine (Ser, S)
n = 49 (8.11%)
Threonine (Thr, T)
n = 53 (8.77%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 22 (3.64%)
Leucine (Leu, L)
n = 77 (12.75%)
Isoleucine (Ile, I)
n = 70 (11.59%)
Methionine (Met, M)
n = 33 (5.46%)
Proline (Pro, P)
n = 25 (4.14%)
Phenylalanine (Phe, F)
n = 44 (7.28%)
Tyrosine (Tyr, Y)
n = 12 (1.99%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 12 (1.99%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 42 (6.95%)
Glutamine (Gln, Q)
n = 22 (3.64%)
Histidine (His, H)
n = 10 (1.66%)
Lysine (Lys, K)
n = 19 (3.15%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
53 17 29 23 6 17 2 28 20 2 6 3 12 1 22 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 5 10 13 22 1 8 7 11 3 5 2 17 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 26 1 11 9 18 2 1 8 9 3 1 1 19 23 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 10 1 7 5 17 2 0 0 9 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
120 114 226 145
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 164 129 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 144 248 191
ND6 (size: 513 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (9.41%)
Alanine (Ala, A)
n = 13 (7.65%)
Serine (Ser, S)
n = 20 (11.76%)
Threonine (Thr, T)
n = 0 (0%)
Cysteine (Cys, C)
n = 4 (2.35%)
Valine (Val, V)
n = 29 (17.06%)
Leucine (Leu, L)
n = 19 (11.18%)
Isoleucine (Ile, I)
n = 11 (6.47%)
Methionine (Met, M)
n = 9 (5.29%)
Proline (Pro, P)
n = 4 (2.35%)
Phenylalanine (Phe, F)
n = 8 (4.71%)
Tyrosine (Tyr, Y)
n = 11 (6.47%)
Tryptophan (Trp, W)
n = 11 (6.47%)
Aspartic acid (Asp, D)
n = 2 (1.18%)
Glutamic acid (Glu, E)
n = 4 (2.35%)
Asparagine (Asn, N)
n = 4 (2.35%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.76%)
Arginine (Arg, R)
n = 2 (1.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 0 6 1 0 1 0 11 0 0 13 0 8 8 8 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 1 5 3 3 2 4 0 7 5 4 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 8 0 4 3 4 1 11 0 9 6 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 2 0 1 2 1 1 0 0 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 8 33 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 32 24 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 8 45 77
Total protein-coding genes (size: 11375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 220 (5.81%)
Alanine (Ala, A)
n = 276 (7.28%)
Serine (Ser, S)
n = 301 (7.94%)
Threonine (Thr, T)
n = 307 (8.1%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 179 (4.72%)
Leucine (Leu, L)
n = 601 (15.86%)
Isoleucine (Ile, I)
n = 338 (8.92%)
Methionine (Met, M)
n = 196 (5.17%)
Proline (Pro, P)
n = 204 (5.38%)
Phenylalanine (Phe, F)
n = 228 (6.02%)
Tyrosine (Tyr, Y)
n = 117 (3.09%)
Tryptophan (Trp, W)
n = 117 (3.09%)
Aspartic acid (Asp, D)
n = 74 (1.95%)
Glutamic acid (Glu, E)
n = 97 (2.56%)
Asparagine (Asn, N)
n = 150 (3.96%)
Glutamine (Gln, Q)
n = 99 (2.61%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 66 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
228 110 161 159 54 141 10 217 93 6 62 25 75 17 125 103
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
35 13 18 73 83 114 6 44 40 113 23 52 20 121 11 83
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
71 145 8 66 44 123 11 15 42 60 57 16 20 70 80 40
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
56 83 14 36 38 77 8 10 5 50 1 1 0 4 3 101
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
846 829 1134 981
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
492 1031 725 1542
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
189 846 1619 1136

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.