Viewing data for Budorcas taxicolor


Scientific name Budorcas taxicolor
Common name Takin
Maximum lifespan 21.90 years (Budorcas taxicolor@AnAge)

Total mtDNA (size: 16667 bases) GC AT G C A T
Base content (bases) 6528 10139 4385 2143 4496 5643
Base content per 1 kb (bases) 392 608 263 129 270 339
Base content (%) 39.2% 60.8%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4478 6860 3188 1290 3115 3745
Base content per 1 kb (bases) 395 605 281 114 275 330
Base content (%) 39.5% 60.5%
D-loop (size: 1235 bases) GC AT G C A T
Base content (bases) 465 770 296 169 364 406
Base content per 1 kb (bases) 377 623 240 137 295 329
Base content (%) 37.7% 62.3%
Total tRNA-coding genes (size: 1509 bases) GC AT G C A T
Base content (bases) 545 964 315 230 432 532
Base content per 1 kb (bases) 361 639 209 152 286 353
Base content (%) 36.1% 63.9%
Total rRNA-coding genes (size: 2529 bases) GC AT G C A T
Base content (bases) 1016 1513 572 444 578 935
Base content per 1 kb (bases) 402 598 226 176 229 370
Base content (%) 40.2% 59.8%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 414 541 236 178 199 342
Base content per 1 kb (bases) 434 566 247 186 208 358
Base content (%) 43.4% 56.6%
16S rRNA gene (size: 1574 bases) GC AT G C A T
Base content (bases) 602 972 336 266 379 593
Base content per 1 kb (bases) 382 618 213 169 241 377
Base content (%) 38.2% 61.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 268 413 192 76 193 220
Base content per 1 kb (bases) 394 606 282 112 283 323
Base content (%) 39.4% 60.6%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 65 136 50 15 55 81
Base content per 1 kb (bases) 323 677 249 75 274 403
Base content (%) 32.3% 67.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 632 913 382 250 463 450
Base content per 1 kb (bases) 409 591 247 162 300 291
Base content (%) 40.9% 59.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 264 420 172 92 180 240
Base content per 1 kb (bases) 386 614 251 135 263 351
Base content (%) 38.6% 61.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 360 424 250 110 213 211
Base content per 1 kb (bases) 459 541 319 140 272 269
Base content (%) 45.9% 54.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 475 665 332 143 299 366
Base content per 1 kb (bases) 417 583 291 125 262 321
Base content (%) 41.7% 58.3%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 375 581 273 102 271 310
Base content per 1 kb (bases) 392 608 286 107 283 324
Base content (%) 39.2% 60.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 367 675 289 78 278 397
Base content per 1 kb (bases) 352 648 277 75 267 381
Base content (%) 35.2% 64.8%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 141 205 103 38 97 108
Base content per 1 kb (bases) 408 592 298 110 280 312
Base content (%) 40.8% 59.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 546 832 402 144 385 447
Base content per 1 kb (bases) 396 604 292 104 279 324
Base content (%) 39.6% 60.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 117 180 77 40 91 89
Base content per 1 kb (bases) 394 606 259 135 306 300
Base content (%) 39.4% 60.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 698 1123 526 172 499 624
Base content per 1 kb (bases) 383 617 289 94 274 343
Base content (%) 38.3% 61.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 190 338 154 36 113 225
Base content per 1 kb (bases) 360 640 292 68 214 426
Base content (%) 36.0% 64.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 28 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 10 (4.42%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 13 (5.75%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 8 6 6 7 13 1 16 9 0 3 1 7 1 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 6 7 0 0 4 5 2 4 3 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 0 2 2 5 0 0 4 1 1 0 2 6 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 4 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 58 80 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 66 39 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 68 101 48
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLVLFIVLQLKISKHDFYYNPKLMTTKTPKQDAPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 8 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.03%)
Leucine (Leu, L)
n = 12 (18.18%)
Isoleucine (Ile, I)
n = 4 (6.06%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 3 (4.55%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 3 (4.55%)
Glutamic acid (Glu, E)
n = 1 (1.52%)
Asparagine (Asn, N)
n = 1 (1.52%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 7 (10.61%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 3 1 3 2 1 5 3 0 1 1 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 2 1 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 3 0 0 4 0 0 0 2 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 1 2 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 17 24 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 19 20 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 14 37 11
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 40 (7.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.81%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 28 8 7 26 5 14 5 1 6 5 21 3 22 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 8 14 18 0 7 8 28 4 12 8 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 16 3 5 10 12 0 2 1 9 10 2 0 9 10 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 2 5 11 9 0 1 1 4 2 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 105 142 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 142 212 134
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 16 (7.05%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 6 14 0 5 16 4 8 5 1 4 1 6 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 3 0 6 0 0 4 4 0 2 3 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 2 5 8 0 1 4 6 4 1 1 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 15 1 2 8 3 2 2 0 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 57 68 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 60 112 44
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 8 (3.08%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 6 7 9 11 1 5 7 0 1 8 7 0 6 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 5 8 3 0 1 10 6 1 2 6 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 1 3 5 7 0 2 4 5 6 0 0 2 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 0 1 2 2 0 1 2 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 69 63 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 114 92 49
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 31 (8.18%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 20 (5.28%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 33 16 3 18 18 2 13 5 1 2 4 9 0 9 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 3 4 14 0 0 7 16 1 1 6 13 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 1 8 11 0 0 3 10 5 1 1 5 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 2 9 7 2 0 0 8 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 89 124 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 94 77 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 149 165 52
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 24 (7.57%)
Threonine (Thr, T)
n = 20 (6.31%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 10 (3.15%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 34 (10.73%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 19 (5.99%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 19 17 7 10 29 0 10 7 0 2 0 8 0 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 4 11 14 0 0 5 7 0 2 12 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 13 1 3 5 12 1 1 2 5 7 0 0 6 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 3 0 7 0 0 1 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 86 95 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 92 55 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 95 159 60
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 42 (12.14%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 18 (5.2%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 21 39 5 10 27 1 9 10 0 1 0 5 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 10 6 0 0 5 9 0 3 5 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 0 1 9 15 1 0 2 3 5 0 1 4 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 81 157 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 59 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 106 181 54
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 42 (12.14%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 18 (5.2%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 21 39 5 10 27 1 9 10 0 1 0 5 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 10 6 0 0 5 9 0 3 5 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 0 1 9 15 1 0 2 3 5 0 1 4 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 81 157 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 59 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 106 181 54
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 37 (8.08%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 21 31 15 16 48 4 9 9 2 4 1 6 0 9 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 4 10 13 1 1 7 9 1 1 9 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 20 2 6 13 10 1 1 10 4 12 1 1 8 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 0 1 3 11 0 2 2 5 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 136 161 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 115 84 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 151 202 86
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 14 (14.29%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 10 1 3 11 2 3 2 0 2 0 4 1 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 1 2 4 0 0 2 2 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 1 2 5 2 0 1 0 1 3 0 2 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 23 29 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 22 17 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 32 43 14
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 34 (5.61%)
Serine (Ser, S)
n = 46 (7.59%)
Threonine (Thr, T)
n = 64 (10.56%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 11 (1.82%)
Leucine (Leu, L)
n = 92 (15.18%)
Isoleucine (Ile, I)
n = 70 (11.55%)
Methionine (Met, M)
n = 35 (5.78%)
Proline (Pro, P)
n = 28 (4.62%)
Phenylalanine (Phe, F)
n = 43 (7.1%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
37 33 33 14 15 45 3 15 17 1 0 5 6 0 15 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 3 12 19 0 1 9 17 0 4 9 14 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 29 2 7 15 12 1 5 6 7 13 1 0 10 27 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 3 3 6 21 2 1 4 2 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
93 144 240 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 161 133 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 221 251 118
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 5 (2.86%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 23 (13.14%)
Leucine (Leu, L)
n = 16 (9.14%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 12 (6.86%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 11 (6.29%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 0 3 0 0 0 0 10 0 1 9 0 5 9 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 0 4 1 0 0 12 1 3 10 3 0 0 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 2 5 0 1 1 3 1 8 3 2 6 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 8 4 0 1 4 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 5 51 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 24 34 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 7 28 89
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 212 (5.58%)
Alanine (Ala, A)
n = 232 (6.11%)
Serine (Ser, S)
n = 278 (7.32%)
Threonine (Thr, T)
n = 337 (8.87%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 162 (4.27%)
Leucine (Leu, L)
n = 597 (15.72%)
Isoleucine (Ile, I)
n = 353 (9.29%)
Methionine (Met, M)
n = 257 (6.77%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 235 (6.19%)
Tyrosine (Tyr, Y)
n = 134 (3.53%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 168 (4.42%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 94 (2.47%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
185 168 211 73 109 258 24 118 82 7 35 26 86 15 102 133
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 4 18 43 82 106 1 22 62 109 19 37 65 88 3 55
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
102 164 16 38 79 101 5 16 39 62 72 9 15 57 111 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
72 81 14 23 44 88 10 8 13 39 4 1 0 7 0 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
768 904 1269 858
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
458 985 752 1604
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
188 1195 1634 782

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.