Viewing data for Aythya americana


Scientific name Aythya americana
Common name Redhead
Maximum lifespan 22.60 years (Aythya americana@AnAge)

Total mtDNA (size: 16616 bases) GC AT G C A T
Base content (bases) 8038 8578 5442 2596 3695 4883
Base content per 1 kb (bases) 484 516 328 156 222 294
Base content (%) 48.4% 51.6%
Total protein-coding genes (size: 11390 bases) GC AT G C A T
Base content (bases) 5629 5761 3990 1639 2544 3217
Base content per 1 kb (bases) 494 506 350 144 223 282
Base content (%) 49.4% 50.6%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1541 bases) GC AT G C A T
Base content (bases) 677 864 397 280 377 487
Base content per 1 kb (bases) 439 561 258 182 245 316
Base content (%) 43.9% 56.1%
Total rRNA-coding genes (size: 2586 bases) GC AT G C A T
Base content (bases) 1210 1376 693 517 503 873
Base content per 1 kb (bases) 468 532 268 200 195 338
Base content (%) 46.8% 53.2%
12S rRNA gene (size: 982 bases) GC AT G C A T
Base content (bases) 480 502 278 202 186 316
Base content per 1 kb (bases) 489 511 283 206 189 322
Base content (%) 48.9% 51.1%
16S rRNA gene (size: 1604 bases) GC AT G C A T
Base content (bases) 730 874 415 315 317 557
Base content per 1 kb (bases) 455 545 259 196 198 347
Base content (%) 45.5% 54.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 331 353 253 78 159 194
Base content per 1 kb (bases) 484 516 370 114 232 284
Base content (%) 48.4% 51.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 80 88 67 13 31 57
Base content per 1 kb (bases) 476 524 399 77 185 339
Base content (%) 47.6% 52.4%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 783 768 515 268 369 399
Base content per 1 kb (bases) 505 495 332 173 238 257
Base content (%) 50.5% 49.5%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 338 349 224 114 152 197
Base content per 1 kb (bases) 492 508 326 166 221 287
Base content (%) 49.2% 50.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 392 392 265 127 181 211
Base content per 1 kb (bases) 500 500 338 162 231 269
Base content (%) 50.0% 50.0%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 568 575 406 162 268 307
Base content per 1 kb (bases) 497 503 355 142 234 269
Base content (%) 49.7% 50.3%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 489 489 335 154 242 247
Base content per 1 kb (bases) 500 500 343 157 247 253
Base content (%) 50.0% 50.0%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 511 530 375 136 227 303
Base content per 1 kb (bases) 491 509 360 131 218 291
Base content (%) 49.1% 50.9%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 179 173 123 56 84 89
Base content per 1 kb (bases) 509 491 349 159 239 253
Base content (%) 50.9% 49.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 659 719 492 167 318 401
Base content per 1 kb (bases) 478 522 357 121 231 291
Base content (%) 47.8% 52.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 156 141 102 54 70 71
Base content per 1 kb (bases) 525 475 343 182 236 239
Base content (%) 52.5% 47.5%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 884 940 634 250 396 544
Base content per 1 kb (bases) 485 515 348 137 217 298
Base content (%) 48.5% 51.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 264 258 202 62 51 207
Base content per 1 kb (bases) 506 494 387 119 98 397
Base content (%) 50.6% 49.4%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 7 8 14 27 6 5 6 1 0 5 3 0 0 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 0 12 5 0 1 4 2 1 1 8 7 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 3 1 6 4 0 0 6 2 2 0 1 1 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 3 1 0 0 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 88 68 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 65 34 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 100 92 19
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMIMTWLTLALLIQPKLLTFTTTNPPSSKPSLTTKPTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 1 0 4 3 1 0 1 1 0 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 2 0 0 0 0 0 1 3 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 0 1 2 0 0 1 0 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 20 22 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 26 8 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 21 27 4
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 43 (8.33%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 32 20 3 18 26 9 6 6 4 4 13 13 4 8 34
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 7 30 9 0 4 17 19 7 6 12 10 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 15 0 4 10 8 2 0 3 3 14 2 1 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 9 1 1 14 8 1 0 1 6 1 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 123 134 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 253 170 55
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 19 (8.33%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 7 (3.07%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 6 2 9 13 4 2 7 0 5 2 10 2 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 4 9 3 0 0 4 3 2 0 5 8 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 0 1 8 6 3 0 3 0 8 1 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 3 2 11 3 1 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 64 49 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 62 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 100 86 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 14 6 0 11 13 4 3 5 1 1 6 6 1 6 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 12 8 0 0 9 9 1 2 3 6 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 0 1 7 4 1 1 4 1 8 1 1 1 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 1 1 4 4 0 0 0 4 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 69 60 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 126 97 22
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 30 (7.89%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 30 (7.89%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 26 6 6 16 30 8 2 7 1 2 5 9 2 3 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 5 1 21 7 1 0 8 11 4 1 11 12 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 5 2 2 8 12 1 0 2 3 10 1 1 3 18 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 1 0 7 8 2 0 2 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 112 97 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 78 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 191 132 30
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 29 (8.92%)
Threonine (Thr, T)
n = 17 (5.23%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 61 (18.77%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 18 (5.54%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 10 (3.08%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 16 12 6 15 28 8 3 4 2 1 8 6 2 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 5 17 8 0 1 4 3 6 3 16 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 2 3 9 9 2 0 6 1 13 2 1 2 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 5 0 4 6 1 0 1 6 1 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 98 83 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 95 54 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 142 110 35
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 36 (10.4%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 35 (10.12%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 15 (4.34%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 25 (7.23%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 24 (6.94%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 16 10 5 17 32 9 2 4 5 0 8 5 2 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 6 16 13 1 0 6 3 2 1 9 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 16 3 4 13 7 2 0 6 1 7 4 0 0 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 0 1 14 0 1 1 1 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 108 111 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 121 60 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 146 132 32
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 36 (10.4%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 35 (10.12%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 15 (4.34%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 25 (7.23%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 24 (6.94%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 16 10 5 17 32 9 2 4 5 0 8 5 2 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 6 16 13 1 0 6 3 2 1 9 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 16 3 4 13 7 2 0 6 1 7 4 0 0 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 0 1 14 0 1 1 1 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 108 111 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 121 60 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 146 132 32
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 48 (10.48%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 102 (22.27%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 15 (3.28%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 31 11 8 24 51 12 7 11 1 0 5 5 0 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 0 3 7 14 10 0 0 8 9 3 2 12 14 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 19 1 3 14 12 1 0 9 2 11 2 0 1 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 0 2 9 1 1 2 8 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 162 144 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 137 73 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 193 184 44
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 2 1 3 8 6 0 2 0 0 1 3 1 0 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 1 4 1 1 1 2 1 2 1 2 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 3 4 1 0 3 0 1 1 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 1 0 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 32 25 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 27 17 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 43 29 10
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.44%)
Alanine (Ala, A)
n = 60 (9.88%)
Serine (Ser, S)
n = 38 (6.26%)
Threonine (Thr, T)
n = 63 (10.38%)
Cysteine (Cys, C)
n = 7 (1.15%)
Valine (Val, V)
n = 21 (3.46%)
Leucine (Leu, L)
n = 107 (17.63%)
Isoleucine (Ile, I)
n = 49 (8.07%)
Methionine (Met, M)
n = 30 (4.94%)
Proline (Pro, P)
n = 31 (5.11%)
Phenylalanine (Phe, F)
n = 34 (5.6%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 14 (2.31%)
Asparagine (Asn, N)
n = 25 (4.12%)
Glutamine (Gln, Q)
n = 19 (3.13%)
Histidine (His, H)
n = 15 (2.47%)
Lysine (Lys, K)
n = 23 (3.79%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 37 25 5 30 51 13 8 16 3 1 6 13 1 8 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 7 4 34 19 3 0 13 15 5 2 12 15 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 18 0 3 17 7 1 1 9 0 11 3 0 4 21 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 4 0 6 19 4 0 4 4 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
134 173 200 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 182 114 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 279 230 54
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.03%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 36 (20.81%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 0 3 1 1 5 4 0 0 19 1 7 9 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 3 2 5 8 6 1 1 18 3 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 0 1 3 3 0 7 0 4 12 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 2 1 0 0 1 0 1 4 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 20 15 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 34 15 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 8 21 71
Total protein-coding genes (size: 11408 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.81%)
Alanine (Ala, A)
n = 331 (8.71%)
Serine (Ser, S)
n = 280 (7.37%)
Threonine (Thr, T)
n = 309 (8.13%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 198 (5.21%)
Leucine (Leu, L)
n = 666 (17.52%)
Isoleucine (Ile, I)
n = 279 (7.34%)
Methionine (Met, M)
n = 170 (4.47%)
Proline (Pro, P)
n = 231 (6.08%)
Phenylalanine (Phe, F)
n = 223 (5.87%)
Tyrosine (Tyr, Y)
n = 107 (2.82%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 61 (1.6%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 121 (3.18%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 109 (2.87%)
Lysine (Lys, K)
n = 89 (2.34%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
69 210 109 48 170 298 91 42 71 21 33 60 81 24 52 171
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
61 2 27 43 180 94 14 13 77 80 51 25 95 101 10 36
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
149 113 11 26 98 81 17 6 52 20 87 23 17 16 105 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
98 74 21 7 54 78 11 3 15 46 9 0 2 7 2 84
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
906 1112 1028 756
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1093 683 1536
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
385 1648 1359 410

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.