Viewing data for Andrias japonicus


Scientific name Andrias japonicus
Common name Japanese giant salamander
Maximum lifespan 55.00 years (Andrias japonicus@AnAge)

Total mtDNA (size: 16298 bases) GC AT G C A T
Base content (bases) 5773 10525 3420 2353 5301 5224
Base content per 1 kb (bases) 354 646 210 144 325 321
Base content (%) 35.4% 64.6%
Total protein-coding genes (size: 11352 bases) GC AT G C A T
Base content (bases) 4025 7327 2475 1550 3858 3469
Base content per 1 kb (bases) 355 645 218 137 340 306
Base content (%) 35.5% 64.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1532 bases) GC AT G C A T
Base content (bases) 550 982 299 251 465 517
Base content per 1 kb (bases) 359 641 195 164 304 337
Base content (%) 35.9% 64.1%
Total rRNA-coding genes (size: 2492 bases) GC AT G C A T
Base content (bases) 881 1611 460 421 667 944
Base content per 1 kb (bases) 354 646 185 169 268 379
Base content (%) 35.4% 64.6%
12S rRNA gene (size: 915 bases) GC AT G C A T
Base content (bases) 347 568 185 162 233 335
Base content per 1 kb (bases) 379 621 202 177 255 366
Base content (%) 37.9% 62.1%
16S rRNA gene (size: 1577 bases) GC AT G C A T
Base content (bases) 534 1043 275 259 434 609
Base content per 1 kb (bases) 339 661 174 164 275 386
Base content (%) 33.9% 66.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 228 456 146 82 248 208
Base content per 1 kb (bases) 333 667 213 120 363 304
Base content (%) 33.3% 66.7%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 47 121 33 14 55 66
Base content per 1 kb (bases) 280 720 196 83 327 393
Base content (%) 28.0% 72.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 611 940 330 281 536 404
Base content per 1 kb (bases) 394 606 213 181 346 260
Base content (%) 39.4% 60.6%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 244 444 146 98 225 219
Base content per 1 kb (bases) 355 645 212 142 327 318
Base content (%) 35.5% 64.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 293 491 164 129 279 212
Base content per 1 kb (bases) 374 626 209 165 356 270
Base content (%) 37.4% 62.6%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 454 687 289 165 363 324
Base content per 1 kb (bases) 398 602 253 145 318 284
Base content (%) 39.8% 60.2%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 344 628 217 127 331 297
Base content per 1 kb (bases) 354 646 223 131 341 306
Base content (%) 35.4% 64.6%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 338 703 232 106 357 346
Base content per 1 kb (bases) 325 675 223 102 343 332
Base content (%) 32.5% 67.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 127 224 79 48 127 97
Base content per 1 kb (bases) 362 638 225 137 362 276
Base content (%) 36.2% 63.8%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 466 911 297 169 484 427
Base content per 1 kb (bases) 338 662 216 123 351 310
Base content (%) 33.8% 66.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 107 190 64 43 104 86
Base content per 1 kb (bases) 360 640 215 145 350 290
Base content (%) 36.0% 64.0%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 600 1212 363 237 646 566
Base content per 1 kb (bases) 331 669 200 131 357 312
Base content (%) 33.1% 66.9%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 176 343 121 55 112 231
Base content per 1 kb (bases) 339 661 233 106 216 445
Base content (%) 33.9% 66.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 52 (22.91%)
Isoleucine (Ile, I)
n = 23 (10.13%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 3 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 7 10 10 1 5 5 29 7 1 3 3 5 1 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 2 5 0 4 1 1 3 8 3 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 11 1 3 3 3 0 0 4 3 0 1 2 9 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 1 4 2 1 1 1 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 53 75 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 58 37 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 35 96 77
ATP8 (size: 168 bases)
Amino acid sequence: MPQLSPGPWFAIFMISWMILLLILMPKINNLKNMNEPTSTGLFLNKPQSWNWPWI*
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (3.64%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 2 (3.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 5 (9.09%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 6 (10.91%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 5 0 0 1 0 6 2 0 0 0 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 0 1 0 0 0 1 1 0 0 1 5 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 2 1 1 0 0 0 0 0 0 1 5 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 1 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 10 22 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 14 13 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 9 31 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.72%)
Alanine (Ala, A)
n = 42 (8.14%)
Serine (Ser, S)
n = 37 (7.17%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 60 (11.63%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 29 (5.62%)
Proline (Pro, P)
n = 27 (5.23%)
Phenylalanine (Phe, F)
n = 38 (7.36%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 16 (3.1%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
36 4 23 12 3 11 3 26 5 2 16 4 14 5 25 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 13 15 10 4 11 14 11 9 10 4 8 5 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 19 2 6 8 16 1 2 4 13 6 4 5 14 2 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 3 7 8 6 2 4 2 2 1 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 92 136 138
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 96 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 101 172 192
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 15 (6.58%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 16 (7.02%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.39%)
Leucine (Leu, L)
n = 26 (11.4%)
Isoleucine (Ile, I)
n = 25 (10.96%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 13 (5.7%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 12 (5.26%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 8 (3.51%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 5 15 5 0 6 2 11 7 1 6 0 3 1 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 5 3 7 0 2 3 2 1 2 2 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 0 6 2 5 0 2 3 8 0 2 2 4 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 3 8 4 3 0 1 3 2 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 48 74 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 57 59 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 41 86 87
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 12 (4.62%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 27 (10.38%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 16 (6.15%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 26 (10.0%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 4 14 8 0 6 1 12 7 1 9 2 4 2 22 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 6 8 5 0 3 8 4 5 5 1 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 3 5 1 0 0 3 11 1 2 0 0 2 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 2 3 3 2 0 1 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 53 63 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 60 54 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 51 95 100
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 20 (5.28%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 20 (5.28%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 33 (8.71%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 11 12 14 13 13 7 12 4 3 7 3 9 1 17 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 8 7 1 4 6 11 7 4 4 15 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 4 3 15 0 0 3 12 3 2 2 7 9 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 7 0 5 4 10 0 0 2 7 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 99 102 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 92 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 98 146 110
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.26%)
Alanine (Ala, A)
n = 23 (7.12%)
Serine (Ser, S)
n = 23 (7.12%)
Threonine (Thr, T)
n = 25 (7.74%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 16 (4.95%)
Leucine (Leu, L)
n = 47 (14.55%)
Isoleucine (Ile, I)
n = 34 (10.53%)
Methionine (Met, M)
n = 18 (5.57%)
Proline (Pro, P)
n = 23 (7.12%)
Phenylalanine (Phe, F)
n = 21 (6.5%)
Tyrosine (Tyr, Y)
n = 14 (4.33%)
Tryptophan (Trp, W)
n = 9 (2.79%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 9 (2.79%)
Asparagine (Asn, N)
n = 12 (3.72%)
Glutamine (Gln, Q)
n = 5 (1.55%)
Histidine (His, H)
n = 4 (1.24%)
Lysine (Lys, K)
n = 9 (2.79%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 10 17 6 3 9 1 24 5 0 6 3 5 2 15 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 5 6 11 1 4 6 3 4 5 4 13 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 0 5 4 12 0 2 0 9 5 1 4 8 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 2 4 0 9 0 2 1 3 2 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 59 100 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 92 58 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 66 139 99
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 25 (7.23%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 30 (8.67%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 69 (19.94%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 13 (3.76%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 9 29 8 8 15 1 33 10 1 2 0 3 3 11 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 10 9 1 5 3 2 2 3 1 7 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 9 7 11 0 2 3 3 4 1 4 11 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 1 1 10 0 1 0 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 68 127 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 95 60 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 69 159 98
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 25 (7.23%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 30 (8.67%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 69 (19.94%)
Isoleucine (Ile, I)
n = 32 (9.25%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 13 (3.76%)
Phenylalanine (Phe, F)
n = 16 (4.62%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 9 29 8 8 15 1 33 10 1 2 0 3 3 11 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 5 10 9 1 5 3 2 2 3 1 7 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 9 7 11 0 2 3 3 4 1 4 11 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 1 1 10 0 1 0 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 68 127 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 95 60 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 69 159 98
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 87 (19.0%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 18 (3.93%)
Tyrosine (Tyr, Y)
n = 19 (4.15%)
Tryptophan (Trp, W)
n = 16 (3.49%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 9 (1.97%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 8 29 18 2 16 5 45 10 2 8 2 7 1 13 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 2 7 15 8 1 7 8 2 3 4 6 12 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 0 5 8 14 0 5 5 15 4 3 1 16 4 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 3 0 3 8 1 2 3 2 2 0 0 0 1 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 94 152 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 116 84 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 87 191 153
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 9 (9.18%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 3 (3.06%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 8 4 0 3 1 8 1 0 0 0 2 0 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 1 6 3 0 2 1 1 1 0 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 2 1 2 1 0 1 2 1 0 2 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 1 0 3 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 16 29 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 25 18 44
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 23 39 27
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.98%)
Alanine (Ala, A)
n = 44 (7.3%)
Serine (Ser, S)
n = 55 (9.12%)
Threonine (Thr, T)
n = 41 (6.8%)
Cysteine (Cys, C)
n = 10 (1.66%)
Valine (Val, V)
n = 16 (2.65%)
Leucine (Leu, L)
n = 94 (15.59%)
Isoleucine (Ile, I)
n = 68 (11.28%)
Methionine (Met, M)
n = 35 (5.8%)
Proline (Pro, P)
n = 24 (3.98%)
Phenylalanine (Phe, F)
n = 44 (7.3%)
Tyrosine (Tyr, Y)
n = 17 (2.82%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 14 (2.32%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 27 (4.48%)
Glutamine (Gln, Q)
n = 20 (3.32%)
Histidine (His, H)
n = 10 (1.66%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 10 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
52 16 31 13 3 20 5 44 16 4 4 2 8 2 35 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 6 4 11 11 20 2 7 9 9 5 9 1 11 3 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 3 14 9 16 2 7 7 11 6 3 9 17 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 10 1 9 5 19 2 2 0 7 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
115 105 206 178
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 150 121 257
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 108 239 211
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.79%)
Alanine (Ala, A)
n = 14 (8.14%)
Serine (Ser, S)
n = 12 (6.98%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 3 (1.74%)
Valine (Val, V)
n = 14 (8.14%)
Leucine (Leu, L)
n = 26 (15.12%)
Isoleucine (Ile, I)
n = 13 (7.56%)
Methionine (Met, M)
n = 9 (5.23%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 20 (11.63%)
Tyrosine (Tyr, Y)
n = 11 (6.4%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 5 (2.91%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 2 (1.16%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 0 5 1 0 2 0 18 0 2 3 0 8 3 17 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 4 3 5 2 6 1 7 8 1 0 2 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 8 0 3 0 0 1 10 1 1 5 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 2 1 0 0 3 0 0 0 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 12 31 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 33 24 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 10 57 77
Total protein-coding genes (size: 11385 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.91%)
Alanine (Ala, A)
n = 266 (7.01%)
Serine (Ser, S)
n = 282 (7.43%)
Threonine (Thr, T)
n = 273 (7.2%)
Cysteine (Cys, C)
n = 33 (0.87%)
Valine (Val, V)
n = 175 (4.61%)
Leucine (Leu, L)
n = 603 (15.9%)
Isoleucine (Ile, I)
n = 348 (9.17%)
Methionine (Met, M)
n = 242 (6.38%)
Proline (Pro, P)
n = 194 (5.11%)
Phenylalanine (Phe, F)
n = 250 (6.59%)
Tyrosine (Tyr, Y)
n = 131 (3.45%)
Tryptophan (Trp, W)
n = 113 (2.98%)
Aspartic acid (Asp, D)
n = 74 (1.95%)
Glutamic acid (Glu, E)
n = 92 (2.43%)
Asparagine (Asn, N)
n = 139 (3.66%)
Glutamine (Gln, Q)
n = 94 (2.48%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 70 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
271 77 201 106 34 111 32 282 77 17 66 19 68 22 183 67
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 17 16 68 94 92 12 56 63 55 50 53 28 98 15 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
74 132 6 69 52 102 4 20 35 100 31 20 38 95 44 56
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
40 72 20 44 30 78 7 17 14 33 6 0 1 7 2 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
831 737 1143 1083
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
496 960 720 1618
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
293 718 1501 1282

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.