Viewing data for Apalone ferox


Scientific name Apalone ferox
Common name Florida softshell turtle
Maximum lifespan 26.20 years (Apalone ferox@AnAge)

Total mtDNA (size: 16866 bases) GC AT G C A T
Base content (bases) 6546 10320 4551 1995 4281 6039
Base content per 1 kb (bases) 388 612 270 118 254 358
Base content (%) 38.8% 61.2%
Total protein-coding genes (size: 11328 bases) GC AT G C A T
Base content (bases) 4508 6820 3296 1212 2820 4000
Base content per 1 kb (bases) 398 602 291 107 249 353
Base content (%) 39.8% 60.2%
D-loop (size: 1357 bases) GC AT G C A T
Base content (bases) 443 914 303 140 485 429
Base content per 1 kb (bases) 326 674 223 103 357 316
Base content (%) 32.6% 67.4%
Total tRNA-coding genes (size: 1553 bases) GC AT G C A T
Base content (bases) 581 972 353 228 420 552
Base content per 1 kb (bases) 374 626 227 147 270 355
Base content (%) 37.4% 62.6%
Total rRNA-coding genes (size: 2583 bases) GC AT G C A T
Base content (bases) 1001 1582 591 410 548 1034
Base content per 1 kb (bases) 388 612 229 159 212 400
Base content (%) 38.8% 61.2%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 400 572 241 159 201 371
Base content per 1 kb (bases) 412 588 248 164 207 382
Base content (%) 41.2% 58.8%
16S rRNA gene (size: 1611 bases) GC AT G C A T
Base content (bases) 601 1010 350 251 347 663
Base content per 1 kb (bases) 373 627 217 156 215 412
Base content (%) 37.3% 62.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 275 409 214 61 162 247
Base content per 1 kb (bases) 402 598 313 89 237 361
Base content (%) 40.2% 59.8%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 55 110 48 7 38 72
Base content per 1 kb (bases) 333 667 291 42 230 436
Base content (%) 33.3% 66.7%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 648 894 398 250 430 464
Base content per 1 kb (bases) 420 580 258 162 279 301
Base content (%) 42.0% 58.0%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 264 423 180 84 170 253
Base content per 1 kb (bases) 384 616 262 122 247 368
Base content (%) 38.4% 61.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 335 449 220 115 198 251
Base content per 1 kb (bases) 427 573 281 147 253 320
Base content (%) 42.7% 57.3%
CYTB (size: 1144 bases) GC AT G C A T
Base content (bases) 484 660 356 128 285 375
Base content per 1 kb (bases) 423 577 311 112 249 328
Base content (%) 42.3% 57.7%
ND1 (size: 971 bases) GC AT G C A T
Base content (bases) 377 594 273 104 269 325
Base content per 1 kb (bases) 388 612 281 107 277 335
Base content (%) 38.8% 61.2%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 392 647 307 85 248 399
Base content per 1 kb (bases) 377 623 295 82 239 384
Base content (%) 37.7% 62.3%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 137 213 100 37 97 116
Base content per 1 kb (bases) 391 609 286 106 277 331
Base content (%) 39.1% 60.9%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 538 843 419 119 330 513
Base content per 1 kb (bases) 390 610 303 86 239 371
Base content (%) 39.0% 61.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 116 181 90 26 82 99
Base content per 1 kb (bases) 391 609 303 88 276 333
Base content (%) 39.1% 60.9%
ND5 (size: 1779 bases) GC AT G C A T
Base content (bases) 694 1085 530 164 445 640
Base content per 1 kb (bases) 390 610 298 92 250 360
Base content (%) 39.0% 61.0%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 198 330 164 34 73 257
Base content per 1 kb (bases) 375 625 311 64 138 487
Base content (%) 37.5% 62.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 12 (5.29%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 28 (12.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 24 (10.57%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 5 (2.2%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 11 (4.85%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 17 12 2 4 34 3 9 11 0 1 1 4 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 7 3 1 0 2 6 0 3 3 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 15 0 1 4 6 0 0 3 1 2 0 1 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 3 0 0 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
31 78 84 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 67 37 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 69 126 24
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWLSILLITWLTYITIYQPKITSFLQTNSITHNYKHSNTNPWNWPWI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (7.41%)
Threonine (Thr, T)
n = 7 (12.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (11.11%)
Isoleucine (Ile, I)
n = 7 (12.96%)
Methionine (Met, M)
n = 1 (1.85%)
Proline (Pro, P)
n = 6 (11.11%)
Phenylalanine (Phe, F)
n = 1 (1.85%)
Tyrosine (Tyr, Y)
n = 3 (5.56%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 7 (12.96%)
Glutamine (Gln, Q)
n = 3 (5.56%)
Histidine (His, H)
n = 2 (3.7%)
Lysine (Lys, K)
n = 2 (3.7%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 3 0 0 0 4 0 2 3 0 0 0 0 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 0 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 0 1 0 2 0 0 1 0 3 0 0 1 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 15 25 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 16 18 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 17 29 8
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.97%)
Alanine (Ala, A)
n = 41 (7.99%)
Serine (Ser, S)
n = 34 (6.63%)
Threonine (Thr, T)
n = 42 (8.19%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.21%)
Leucine (Leu, L)
n = 58 (11.31%)
Isoleucine (Ile, I)
n = 39 (7.6%)
Methionine (Met, M)
n = 31 (6.04%)
Proline (Pro, P)
n = 26 (5.07%)
Phenylalanine (Phe, F)
n = 37 (7.21%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 16 (3.12%)
Glutamine (Gln, Q)
n = 8 (1.56%)
Histidine (His, H)
n = 20 (3.9%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 16 25 5 7 21 4 19 8 0 4 7 24 2 14 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 9 17 15 0 9 12 20 5 9 4 13 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 21 0 5 3 20 1 0 5 4 15 3 2 6 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 1 4 11 9 0 0 1 7 0 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 99 143 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 96 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 161 225 104
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 10 (4.39%)
Serine (Ser, S)
n = 14 (6.14%)
Threonine (Thr, T)
n = 20 (8.77%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.26%)
Leucine (Leu, L)
n = 27 (11.84%)
Isoleucine (Ile, I)
n = 21 (9.21%)
Methionine (Met, M)
n = 18 (7.89%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 9 (3.95%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 7 (3.07%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 11 (4.82%)
Lysine (Lys, K)
n = 5 (2.19%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 14 15 2 1 16 0 7 7 0 3 1 7 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 1 4 5 0 0 2 5 1 1 2 10 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 0 3 9 0 0 2 4 5 0 1 1 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 0 2 7 4 1 1 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 57 73 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 56 63 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 67 117 37
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 27 (10.38%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 30 (11.54%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 11 10 0 2 19 1 8 7 0 3 1 9 0 5 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 11 10 0 4 6 8 1 0 3 9 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 0 0 1 8 0 1 3 5 6 0 0 1 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 0 2 2 2 0 0 0 4 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 61 69 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 72 51 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 87 131 37
CYTB (size: 1144 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 20 (5.26%)
Serine (Ser, S)
n = 26 (6.84%)
Threonine (Thr, T)
n = 31 (8.16%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 14 (3.68%)
Leucine (Leu, L)
n = 59 (15.53%)
Isoleucine (Ile, I)
n = 36 (9.47%)
Methionine (Met, M)
n = 19 (5.0%)
Proline (Pro, P)
n = 23 (6.05%)
Phenylalanine (Phe, F)
n = 26 (6.84%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 4 (1.05%)
Asparagine (Asn, N)
n = 26 (6.84%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 28 18 8 10 30 2 9 8 1 0 2 11 1 5 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 4 11 5 0 2 7 12 4 1 5 17 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 1 4 7 14 0 1 0 1 14 1 0 5 21 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 0 0 7 9 0 0 1 7 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 101 122 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 99 81 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 156 172 42
ND1 (size: 971 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.66%)
Alanine (Ala, A)
n = 19 (5.9%)
Serine (Ser, S)
n = 28 (8.7%)
Threonine (Thr, T)
n = 23 (7.14%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.42%)
Leucine (Leu, L)
n = 56 (17.39%)
Isoleucine (Ile, I)
n = 24 (7.45%)
Methionine (Met, M)
n = 29 (9.01%)
Proline (Pro, P)
n = 23 (7.14%)
Phenylalanine (Phe, F)
n = 21 (6.52%)
Tyrosine (Tyr, Y)
n = 14 (4.35%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 15 (4.66%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 1 (0.31%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 16 27 4 4 27 4 17 6 0 0 2 8 1 7 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 0 12 7 0 3 5 3 4 3 5 15 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 4 9 13 0 1 1 6 8 0 0 3 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 0 4 7 0 0 0 7 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 76 100 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 91 58 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 106 166 40
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 24 (6.96%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 41 (11.88%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 30 (8.7%)
Proline (Pro, P)
n = 17 (4.93%)
Phenylalanine (Phe, F)
n = 10 (2.9%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 18 (5.22%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 22 26 5 8 37 0 13 13 0 2 0 1 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 1 10 13 0 0 3 8 2 1 3 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 1 9 14 0 3 3 2 7 0 0 3 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 1 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 91 143 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 106 66 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 110 190 40
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 24 (6.96%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 41 (11.88%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 35 (10.14%)
Methionine (Met, M)
n = 30 (8.7%)
Proline (Pro, P)
n = 17 (4.93%)
Phenylalanine (Phe, F)
n = 10 (2.9%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 18 (5.22%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 22 26 5 8 37 0 13 13 0 2 0 1 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 1 10 13 0 0 3 8 2 1 3 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 1 9 14 0 3 3 2 7 0 0 3 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 1 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 91 143 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 106 66 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 110 190 40
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.14%)
Alanine (Ala, A)
n = 23 (5.01%)
Serine (Ser, S)
n = 34 (7.41%)
Threonine (Thr, T)
n = 58 (12.64%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 6 (1.31%)
Leucine (Leu, L)
n = 90 (19.61%)
Isoleucine (Ile, I)
n = 44 (9.59%)
Methionine (Met, M)
n = 36 (7.84%)
Proline (Pro, P)
n = 25 (5.45%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 11 (2.4%)
Tryptophan (Trp, W)
n = 13 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 19 (4.14%)
Glutamine (Gln, Q)
n = 14 (3.05%)
Histidine (His, H)
n = 15 (3.27%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 9 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 35 34 7 4 60 0 18 13 1 0 2 4 0 3 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 3 13 7 0 2 7 9 1 1 4 20 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 31 0 2 3 21 2 0 6 4 7 0 1 2 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 0 1 2 10 0 0 1 8 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 134 173 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 134 82 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 151 258 44
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (2.04%)
Alanine (Ala, A)
n = 4 (4.08%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 16 (16.33%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 5 (5.1%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 7 (7.14%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 7 (7.14%)
Lysine (Lys, K)
n = 2 (2.04%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 7 2 2 6 1 5 1 0 0 0 2 1 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 0 1 3 0 1 0 0 1 1 1 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 1 3 6 1 0 3 4 3 0 0 1 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 0 2 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
11 26 30 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 26 27 36
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 38 42 14
ND5 (size: 1779 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.22%)
Alanine (Ala, A)
n = 38 (6.42%)
Serine (Ser, S)
n = 54 (9.12%)
Threonine (Thr, T)
n = 72 (12.16%)
Cysteine (Cys, C)
n = 6 (1.01%)
Valine (Val, V)
n = 13 (2.2%)
Leucine (Leu, L)
n = 83 (14.02%)
Isoleucine (Ile, I)
n = 58 (9.8%)
Methionine (Met, M)
n = 43 (7.26%)
Proline (Pro, P)
n = 30 (5.07%)
Phenylalanine (Phe, F)
n = 32 (5.41%)
Tyrosine (Tyr, Y)
n = 12 (2.03%)
Tryptophan (Trp, W)
n = 13 (2.2%)
Aspartic acid (Asp, D)
n = 8 (1.35%)
Glutamic acid (Glu, E)
n = 11 (1.86%)
Asparagine (Asn, N)
n = 29 (4.9%)
Glutamine (Gln, Q)
n = 20 (3.38%)
Histidine (His, H)
n = 15 (2.53%)
Lysine (Lys, K)
n = 23 (3.89%)
Arginine (Arg, R)
n = 7 (1.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 44 41 14 12 38 1 18 20 0 2 4 7 0 8 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 5 2 23 13 0 1 9 15 0 6 1 23 0 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 37 1 6 12 25 1 0 10 4 8 2 0 7 22 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 0 3 5 22 1 0 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 137 235 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 184 119 229
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 209 286 90
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 9 (5.14%)
Serine (Ser, S)
n = 10 (5.71%)
Threonine (Thr, T)
n = 2 (1.14%)
Cysteine (Cys, C)
n = 4 (2.29%)
Valine (Val, V)
n = 29 (16.57%)
Leucine (Leu, L)
n = 24 (13.71%)
Isoleucine (Ile, I)
n = 11 (6.29%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 16 (9.14%)
Tyrosine (Tyr, Y)
n = 13 (7.43%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 7 (4.0%)
Glutamic acid (Glu, E)
n = 2 (1.14%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.29%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 0 3 1 0 0 0 7 0 0 15 0 2 12 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 1 6 0 2 1 11 1 3 9 1 0 2 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 6 0 0 1 3 0 12 1 3 16 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 7 0 0 0 4 0 0 0 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 9 28 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 22 23 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 3 22 99
Total protein-coding genes (size: 11350 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 208 (5.5%)
Alanine (Ala, A)
n = 231 (6.11%)
Serine (Ser, S)
n = 282 (7.46%)
Threonine (Thr, T)
n = 369 (9.76%)
Cysteine (Cys, C)
n = 26 (0.69%)
Valine (Val, V)
n = 150 (3.97%)
Leucine (Leu, L)
n = 592 (15.66%)
Isoleucine (Ile, I)
n = 331 (8.76%)
Methionine (Met, M)
n = 257 (6.8%)
Proline (Pro, P)
n = 208 (5.5%)
Phenylalanine (Phe, F)
n = 209 (5.53%)
Tyrosine (Tyr, Y)
n = 128 (3.39%)
Tryptophan (Trp, W)
n = 107 (2.83%)
Aspartic acid (Asp, D)
n = 61 (1.61%)
Glutamic acid (Glu, E)
n = 85 (2.25%)
Asparagine (Asn, N)
n = 166 (4.39%)
Glutamine (Gln, Q)
n = 102 (2.7%)
Histidine (His, H)
n = 107 (2.83%)
Lysine (Lys, K)
n = 88 (2.33%)
Arginine (Arg, R)
n = 67 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
117 214 221 52 58 304 18 139 100 2 30 21 81 18 68 141
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
36 8 18 32 111 86 2 34 55 91 28 28 31 146 3 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
133 190 2 31 56 142 6 9 38 47 81 9 21 36 130 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
72 81 4 20 41 86 2 5 10 51 1 2 0 5 0 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
735 916 1260 870
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
457 1043 742 1539
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
152 1210 1823 596

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.