Viewing data for Bubalus depressicornis


Scientific name Bubalus depressicornis
Common name Anoa
Maximum lifespan 36.10 years (Bubalus depressicornis@AnAge)

Total mtDNA (size: 16357 bases) GC AT G C A T
Base content (bases) 6624 9731 4343 2281 4322 5409
Base content per 1 kb (bases) 405 595 266 139 264 331
Base content (%) 40.5% 59.5%
Total protein-coding genes (size: 11336 bases) GC AT G C A T
Base content (bases) 4664 6672 3206 1458 3054 3618
Base content per 1 kb (bases) 411 589 283 129 269 319
Base content (%) 41.1% 58.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 570 939 336 234 411 528
Base content per 1 kb (bases) 377 621 222 155 272 349
Base content (%) 37.7% 62.1%
Total rRNA-coding genes (size: 2526 bases) GC AT G C A T
Base content (bases) 1005 1521 561 444 579 942
Base content per 1 kb (bases) 398 602 222 176 229 373
Base content (%) 39.8% 60.2%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 394 563 223 171 213 350
Base content per 1 kb (bases) 412 588 233 179 223 366
Base content (%) 41.2% 58.8%
16S rRNA gene (size: 1569 bases) GC AT G C A T
Base content (bases) 611 958 338 273 366 592
Base content per 1 kb (bases) 389 611 215 174 233 377
Base content (%) 38.9% 61.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 278 403 197 81 186 217
Base content per 1 kb (bases) 408 592 289 119 273 319
Base content (%) 40.8% 59.2%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 72 129 59 13 47 82
Base content per 1 kb (bases) 358 642 294 65 234 408
Base content (%) 35.8% 64.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 668 877 398 270 449 428
Base content per 1 kb (bases) 432 568 258 175 291 277
Base content (%) 43.2% 56.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 280 404 175 105 176 228
Base content per 1 kb (bases) 409 591 256 154 257 333
Base content (%) 40.9% 59.1%
COX3 (size: 781 bases) GC AT G C A T
Base content (bases) 354 427 228 126 223 204
Base content per 1 kb (bases) 453 547 292 161 286 261
Base content (%) 45.3% 54.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 494 646 336 158 289 357
Base content per 1 kb (bases) 433 567 295 139 254 313
Base content (%) 43.3% 56.7%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 396 561 276 120 256 305
Base content per 1 kb (bases) 414 586 288 125 268 319
Base content (%) 41.4% 58.6%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 391 651 294 97 272 379
Base content per 1 kb (bases) 375 625 282 93 261 364
Base content (%) 37.5% 62.5%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 150 196 104 46 94 102
Base content per 1 kb (bases) 434 566 301 133 272 295
Base content (%) 43.4% 56.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 551 827 390 161 393 434
Base content per 1 kb (bases) 400 600 283 117 285 315
Base content (%) 40.0% 60.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 117 180 77 40 91 89
Base content per 1 kb (bases) 394 606 259 135 306 300
Base content (%) 39.4% 60.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 738 1083 531 207 485 598
Base content per 1 kb (bases) 405 595 292 114 266 328
Base content (%) 40.5% 59.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 196 332 156 40 114 218
Base content per 1 kb (bases) 371 629 295 76 216 413
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 12 9 6 8 18 5 8 9 0 2 1 7 2 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 7 6 0 2 4 6 0 1 4 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 14 0 1 2 4 1 3 3 1 1 0 0 5 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 4 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 69 80 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 62 36 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 66 101 48
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLALFIIFQLKISKHSFYLNPEPTPTKTPKQNTPWETKWTKIYLPLSSPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 6 (9.09%)
Threonine (Thr, T)
n = 9 (13.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 3 (4.55%)
Proline (Pro, P)
n = 8 (12.12%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 2 1 2 3 0 4 2 1 0 0 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 1 2 4 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 2 0 0 5 0 0 1 1 1 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 23 18 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 18 38 6
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 16 25 6 7 24 9 9 6 0 7 10 16 5 14 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 9 13 16 2 10 10 18 9 12 6 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 2 5 8 14 1 1 2 9 10 2 3 5 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 0 10 6 8 1 1 2 4 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 105 140 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 96 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 159 192 120
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 10 4 2 17 5 5 6 0 1 6 4 1 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 1 1 6 0 1 3 3 1 2 3 5 3 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 11 1 3 6 7 0 1 4 6 5 1 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 10 5 5 5 4 2 1 0 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 60 69 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 60 98 44
COX3 (size: 781 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.72%)
Alanine (Ala, A)
n = 16 (6.18%)
Serine (Ser, S)
n = 19 (7.34%)
Threonine (Thr, T)
n = 23 (8.88%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.79%)
Leucine (Leu, L)
n = 32 (12.36%)
Isoleucine (Ile, I)
n = 15 (5.79%)
Methionine (Met, M)
n = 10 (3.86%)
Proline (Pro, P)
n = 12 (4.63%)
Phenylalanine (Phe, F)
n = 24 (9.27%)
Tyrosine (Tyr, Y)
n = 11 (4.25%)
Tryptophan (Trp, W)
n = 12 (4.63%)
Aspartic acid (Asp, D)
n = 3 (1.16%)
Glutamic acid (Glu, E)
n = 8 (3.09%)
Asparagine (Asn, N)
n = 8 (3.09%)
Glutamine (Gln, Q)
n = 7 (2.7%)
Histidine (His, H)
n = 16 (6.18%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 4 6 6 5 14 2 3 7 0 3 3 7 2 3 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 3 11 2 0 2 9 4 5 2 5 4 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 2 4 3 7 0 2 3 7 4 0 2 2 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 2 1 2 2 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 67 63 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 96 86 58
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 16 (4.22%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 19 (5.01%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 27 14 3 15 24 5 9 5 1 2 5 5 4 5 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 4 2 6 18 1 1 5 15 3 5 3 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 16 1 2 7 11 0 2 2 3 13 1 0 4 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 2 8 9 0 0 0 8 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 95 115 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 94 77 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 147 165 46
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 24 (7.55%)
Threonine (Thr, T)
n = 20 (6.29%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.4%)
Leucine (Leu, L)
n = 54 (16.98%)
Isoleucine (Ile, I)
n = 30 (9.43%)
Methionine (Met, M)
n = 20 (6.29%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 20 (6.29%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 18 18 0 11 30 1 11 7 0 2 1 7 4 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 9 16 0 0 8 4 1 6 6 10 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 15 0 1 8 11 1 0 3 4 8 3 1 4 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 3 1 2 6 1 0 1 7 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 82 92 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 91 56 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 103 157 42
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 44 (12.72%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 22 42 3 8 26 8 8 10 0 3 3 6 0 9 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 9 6 1 1 4 8 1 1 7 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 18 1 3 8 15 1 0 2 1 6 1 2 5 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 0 11 0 0 0 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 83 146 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 103 56 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 108 177 43
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 44 (12.72%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 22 42 3 8 26 8 8 10 0 3 3 6 0 9 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 9 6 1 1 4 8 1 1 7 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 18 1 3 8 15 1 0 2 1 6 1 2 5 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 0 11 0 0 0 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 83 146 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 103 56 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 108 177 43
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 38 (8.3%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 19 29 14 10 41 10 15 9 2 4 1 10 0 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 6 10 13 0 1 7 6 4 7 5 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 1 10 10 8 0 1 9 6 10 2 4 2 22 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 2 2 2 9 2 1 1 8 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 128 158 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 118 85 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 144 191 91
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 8 3 2 13 2 1 1 0 1 1 4 2 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 1 3 4 0 2 0 2 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 2 6 1 0 0 0 3 1 0 1 3 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 1 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 25 28 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 24 18 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 28 43 19
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 43 (7.1%)
Serine (Ser, S)
n = 47 (7.76%)
Threonine (Thr, T)
n = 55 (9.08%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 20 (3.3%)
Leucine (Leu, L)
n = 84 (13.86%)
Isoleucine (Ile, I)
n = 60 (9.9%)
Methionine (Met, M)
n = 41 (6.77%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 48 (7.92%)
Tyrosine (Tyr, Y)
n = 18 (2.97%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 39 35 11 15 39 5 13 17 2 3 8 8 1 19 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 3 3 19 19 2 1 13 12 2 4 13 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 29 2 9 10 14 1 3 10 7 11 2 1 7 30 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 1 1 9 19 3 0 4 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
113 134 228 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 158 130 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 239 240 100
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 19 (10.86%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 0 5 0 0 1 2 12 1 0 11 2 2 9 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 4 0 0 2 8 1 2 15 2 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 3 1 3 0 4 0 8 1 3 4 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 3 1 3 1 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 8 46 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 24 32 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 8 36 82
Total protein-coding genes (size: 11401 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 250 (6.58%)
Serine (Ser, S)
n = 279 (7.35%)
Threonine (Thr, T)
n = 317 (8.35%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 189 (4.98%)
Leucine (Leu, L)
n = 588 (15.48%)
Isoleucine (Ile, I)
n = 324 (8.53%)
Methionine (Met, M)
n = 262 (6.9%)
Proline (Pro, P)
n = 195 (5.13%)
Phenylalanine (Phe, F)
n = 244 (6.42%)
Tyrosine (Tyr, Y)
n = 130 (3.42%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 167 (4.4%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 91 (2.4%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
149 175 208 60 92 261 58 98 83 6 40 41 77 31 93 151
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
54 6 18 36 97 109 8 29 64 82 42 47 54 88 6 45
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
94 164 14 43 70 103 5 17 41 59 71 16 19 43 124 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
69 72 24 26 40 85 10 5 12 44 2 1 0 8 0 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
818 909 1224 848
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
467 983 742 1607
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
295 1213 1571 720

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.