Viewing data for Apodemus peninsulae


Scientific name Apodemus peninsulae
Common name Korean field mouse
Maximum lifespan 4.40 years (Apodemus peninsulae@AnAge)

Total mtDNA (size: 16269 bases) GC AT G C A T
Base content (bases) 5661 10608 3674 1987 5000 5608
Base content per 1 kb (bases) 348 652 226 122 307 345
Base content (%) 34.8% 65.2%
Total protein-coding genes (size: 11331 bases) GC AT G C A T
Base content (bases) 3978 7353 2731 1247 3556 3797
Base content per 1 kb (bases) 351 649 241 110 314 335
Base content (%) 35.1% 64.9%
D-loop (size: 867 bases) GC AT G C A T
Base content (bases) 295 572 198 97 284 288
Base content per 1 kb (bases) 340 660 228 112 328 332
Base content (%) 34.0% 66.0%
Total tRNA-coding genes (size: 1493 bases) GC AT G C A T
Base content (bases) 499 994 282 217 448 546
Base content per 1 kb (bases) 334 666 189 145 300 366
Base content (%) 33.4% 66.6%
Total rRNA-coding genes (size: 2527 bases) GC AT G C A T
Base content (bases) 867 1660 451 416 697 963
Base content per 1 kb (bases) 343 657 178 165 276 381
Base content (%) 34.3% 65.7%
12S rRNA gene (size: 954 bases) GC AT G C A T
Base content (bases) 336 618 181 155 258 360
Base content per 1 kb (bases) 352 648 190 162 270 377
Base content (%) 35.2% 64.8%
16S rRNA gene (size: 1573 bases) GC AT G C A T
Base content (bases) 531 1042 270 261 439 603
Base content per 1 kb (bases) 338 662 172 166 279 383
Base content (%) 33.8% 66.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 235 446 170 65 222 224
Base content per 1 kb (bases) 345 655 250 95 326 329
Base content (%) 34.5% 65.5%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 73 131 60 13 63 68
Base content per 1 kb (bases) 358 642 294 64 309 333
Base content (%) 35.8% 64.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 582 963 345 237 486 477
Base content per 1 kb (bases) 377 623 223 153 315 309
Base content (%) 37.7% 62.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 240 444 152 88 203 241
Base content per 1 kb (bases) 351 649 222 129 297 352
Base content (%) 35.1% 64.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 298 486 189 109 248 238
Base content per 1 kb (bases) 380 620 241 139 316 304
Base content (%) 38.0% 62.0%
CYTB (size: 1144 bases) GC AT G C A T
Base content (bases) 435 709 290 145 354 355
Base content per 1 kb (bases) 380 620 253 127 309 310
Base content (%) 38.0% 62.0%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 341 614 234 107 315 299
Base content per 1 kb (bases) 357 643 245 112 330 313
Base content (%) 35.7% 64.3%
ND2 (size: 1036 bases) GC AT G C A T
Base content (bases) 318 718 248 70 343 375
Base content per 1 kb (bases) 307 693 239 68 331 362
Base content (%) 30.7% 69.3%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 111 237 79 32 116 121
Base content per 1 kb (bases) 319 681 227 92 333 348
Base content (%) 31.9% 68.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 461 917 324 137 445 472
Base content per 1 kb (bases) 335 665 235 99 323 343
Base content (%) 33.5% 66.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 108 189 75 33 98 91
Base content per 1 kb (bases) 364 636 253 111 330 306
Base content (%) 36.4% 63.6%
ND5 (size: 1819 bases) GC AT G C A T
Base content (bases) 621 1198 442 179 568 630
Base content per 1 kb (bases) 341 659 243 98 312 346
Base content (%) 34.1% 65.9%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 177 342 138 39 116 226
Base content per 1 kb (bases) 341 659 266 75 224 435
Base content (%) 34.1% 65.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 14 (6.19%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 29 (12.83%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 6 (2.65%)
Histidine (His, H)
n = 9 (3.98%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 8 10 13 3 16 0 10 6 0 1 1 8 0 10 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 6 6 0 1 1 8 0 4 0 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 0 3 1 7 0 1 4 2 0 0 0 1 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 5 0 3 1 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 66 82 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 60 37 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 44 105 75
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIISSMATLFVLFQLKISSQSFPTPPSPKTFSTQKTKNPWESKWTKIYLPLSSPLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.49%)
Serine (Ser, S)
n = 11 (16.42%)
Threonine (Thr, T)
n = 9 (13.43%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 7 (10.45%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 2 (2.99%)
Proline (Pro, P)
n = 8 (11.94%)
Phenylalanine (Phe, F)
n = 5 (7.46%)
Tyrosine (Tyr, Y)
n = 1 (1.49%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 1 (1.49%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 6 (8.96%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 0 3 0 3 0 0 4 1 0 1 0 0 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 0 0 0 0 0 0 4 2 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 1 4 1 6 0 0 0 1 0 0 1 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 1 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 19 23 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 29 16 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 12 29 21
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.59%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 36 (7.0%)
Methionine (Met, M)
n = 31 (6.03%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 20 (3.89%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 6 29 9 5 25 3 17 6 0 11 7 19 2 24 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 13 11 17 0 5 9 30 2 6 1 21 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 24 0 7 5 17 0 1 2 12 8 1 1 7 9 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 0 6 10 10 0 1 1 6 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 102 134 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 136 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 107 247 150
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 3 15 6 1 17 0 8 6 0 3 1 8 1 5 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 3 4 2 0 3 2 2 1 3 2 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 10 0 2 4 8 0 2 2 6 3 0 0 6 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 2 7 5 4 1 0 1 5 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 57 69 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 53 62 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 42 110 69
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 7 7 3 13 1 10 7 0 5 2 8 0 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 3 4 7 0 1 5 15 0 2 0 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 0 4 4 9 0 1 2 6 6 0 1 3 4 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 0 2 2 2 2 1 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 64 60 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 64 58 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 61 120 75
CYTB (size: 1144 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.84%)
Alanine (Ala, A)
n = 22 (5.79%)
Serine (Ser, S)
n = 24 (6.32%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 19 (5.0%)
Leucine (Leu, L)
n = 55 (14.47%)
Isoleucine (Ile, I)
n = 44 (11.58%)
Methionine (Met, M)
n = 14 (3.68%)
Proline (Pro, P)
n = 22 (5.79%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 15 (3.95%)
Tryptophan (Trp, W)
n = 12 (3.16%)
Aspartic acid (Asp, D)
n = 11 (2.89%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.47%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.42%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 16 13 9 7 28 3 7 6 0 7 2 9 1 12 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 8 5 9 0 4 8 12 2 1 3 18 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 0 3 4 15 0 0 2 8 7 1 1 8 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 6 5 9 1 1 2 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 96 113 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 92 78 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 102 164 105
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 23 (7.26%)
Serine (Ser, S)
n = 27 (8.52%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 50 (15.77%)
Isoleucine (Ile, I)
n = 32 (10.09%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 16 (5.05%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 12 (3.79%)
Asparagine (Asn, N)
n = 11 (3.47%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 10 17 10 5 22 3 9 6 0 4 2 6 1 13 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 9 5 9 0 4 4 2 2 7 2 13 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 3 4 16 0 4 0 9 7 0 1 4 7 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 1 1 2 7 0 2 2 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 81 94 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 89 60 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 64 145 99
ND2 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.78%)
Alanine (Ala, A)
n = 16 (4.65%)
Serine (Ser, S)
n = 21 (6.1%)
Threonine (Thr, T)
n = 36 (10.47%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 67 (19.48%)
Isoleucine (Ile, I)
n = 47 (13.66%)
Methionine (Met, M)
n = 26 (7.56%)
Proline (Pro, P)
n = 20 (5.81%)
Phenylalanine (Phe, F)
n = 13 (3.78%)
Tyrosine (Tyr, Y)
n = 10 (2.91%)
Tryptophan (Trp, W)
n = 8 (2.33%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.4%)
Glutamine (Gln, Q)
n = 12 (3.49%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 12 (3.49%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
39 8 26 24 5 18 1 19 12 0 0 0 5 1 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 8 2 6 0 3 3 7 0 4 4 12 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 16 0 3 1 14 0 0 3 7 3 0 0 4 18 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 12 0 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 90 146 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 90 68 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 68 161 114
ND3 (size: 1036 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.78%)
Alanine (Ala, A)
n = 16 (4.65%)
Serine (Ser, S)
n = 21 (6.1%)
Threonine (Thr, T)
n = 36 (10.47%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.74%)
Leucine (Leu, L)
n = 67 (19.48%)
Isoleucine (Ile, I)
n = 47 (13.66%)
Methionine (Met, M)
n = 26 (7.56%)
Proline (Pro, P)
n = 20 (5.81%)
Phenylalanine (Phe, F)
n = 13 (3.78%)
Tyrosine (Tyr, Y)
n = 10 (2.91%)
Tryptophan (Trp, W)
n = 8 (2.33%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.4%)
Glutamine (Gln, Q)
n = 12 (3.49%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 12 (3.49%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
39 8 26 24 5 18 1 19 12 0 0 0 5 1 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 8 2 6 0 3 3 7 0 4 4 12 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 16 0 3 1 14 0 0 3 7 3 0 0 4 18 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 12 0 0 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 90 146 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 90 68 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 68 161 114
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 47 (10.26%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 82 (17.9%)
Isoleucine (Ile, I)
n = 50 (10.92%)
Methionine (Met, M)
n = 41 (8.95%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 22 (4.8%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 14 (3.06%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
39 11 35 12 8 35 3 23 11 0 5 2 3 0 12 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 5 8 13 0 4 4 9 0 6 4 12 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 18 1 11 2 19 1 5 9 7 5 1 1 7 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 0 2 2 13 1 0 1 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 111 175 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 121 77 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 92 220 132
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 1 (1.02%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 6 2 2 6 0 9 2 0 1 0 4 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 4 5 0 1 1 2 0 1 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 4 3 4 0 0 0 1 1 0 1 3 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 1 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 16 29 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 32 16 43
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 27 46 23
ND5 (size: 1819 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.3%)
Alanine (Ala, A)
n = 32 (5.29%)
Serine (Ser, S)
n = 53 (8.76%)
Threonine (Thr, T)
n = 51 (8.43%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 97 (16.03%)
Isoleucine (Ile, I)
n = 65 (10.74%)
Methionine (Met, M)
n = 42 (6.94%)
Proline (Pro, P)
n = 26 (4.3%)
Phenylalanine (Phe, F)
n = 42 (6.94%)
Tyrosine (Tyr, Y)
n = 20 (3.31%)
Tryptophan (Trp, W)
n = 13 (2.15%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 40 (6.61%)
Glutamine (Gln, Q)
n = 13 (2.15%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 24 (3.97%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
39 26 38 14 15 38 4 25 13 0 2 3 5 3 25 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 5 9 11 12 0 3 5 16 2 1 7 17 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 32 1 12 10 20 2 2 7 12 8 0 1 19 21 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 3 4 6 23 1 0 1 8 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
93 130 231 152
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 153 130 259
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 159 269 156
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.53%)
Alanine (Ala, A)
n = 8 (4.65%)
Serine (Ser, S)
n = 8 (4.65%)
Threonine (Thr, T)
n = 8 (4.65%)
Cysteine (Cys, C)
n = 3 (1.74%)
Valine (Val, V)
n = 17 (9.88%)
Leucine (Leu, L)
n = 22 (12.79%)
Isoleucine (Ile, I)
n = 13 (7.56%)
Methionine (Met, M)
n = 14 (8.14%)
Proline (Pro, P)
n = 3 (1.74%)
Phenylalanine (Phe, F)
n = 15 (8.72%)
Tyrosine (Tyr, Y)
n = 10 (5.81%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 9 (5.23%)
Glutamic acid (Glu, E)
n = 7 (4.07%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 1 (0.58%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 1 6 1 0 1 1 15 0 0 6 0 6 5 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 3 0 5 0 2 1 12 2 3 8 2 0 1 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 0 1 0 2 1 7 3 0 4 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 6 8 1 0 2 0 0 1 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 7 42 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 24 31 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 8 43 87
Total protein-coding genes (size: 11394 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 211 (5.56%)
Alanine (Ala, A)
n = 223 (5.88%)
Serine (Ser, S)
n = 297 (7.83%)
Threonine (Thr, T)
n = 309 (8.14%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 164 (4.32%)
Leucine (Leu, L)
n = 593 (15.63%)
Isoleucine (Ile, I)
n = 372 (9.8%)
Methionine (Met, M)
n = 239 (6.3%)
Proline (Pro, P)
n = 199 (5.24%)
Phenylalanine (Phe, F)
n = 242 (6.38%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 103 (2.71%)
Aspartic acid (Asp, D)
n = 75 (1.98%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 162 (4.27%)
Glutamine (Gln, Q)
n = 82 (2.16%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 103 (2.71%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
269 103 207 114 57 228 20 162 81 1 45 21 83 15 147 95
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 10 18 69 62 91 1 41 44 109 17 42 26 129 2 78
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
66 162 3 61 39 143 3 18 33 79 54 3 12 68 94 49
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
49 80 12 40 35 94 9 8 12 44 0 0 0 6 1 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
765 862 1236 933
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
457 977 752 1610
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
131 808 1719 1138

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.