Viewing data for Gavialis gangeticus


Scientific name Gavialis gangeticus
Common name Indian gavial
Maximum lifespan 28.80 years (Gavialis gangeticus@AnAge)

Total mtDNA (size: 17185 bases) GC AT G C A T
Base content (bases) 7126 10059 4775 2351 4513 5546
Base content per 1 kb (bases) 415 585 278 137 263 323
Base content (%) 41.5% 58.5%
Total protein-coding genes (size: 11350 bases) GC AT G C A T
Base content (bases) 4856 6494 3415 1441 2980 3514
Base content per 1 kb (bases) 428 572 301 127 263 310
Base content (%) 42.8% 57.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1544 bases) GC AT G C A T
Base content (bases) 659 885 383 276 384 501
Base content per 1 kb (bases) 427 573 248 179 249 324
Base content (%) 42.7% 57.3%
Total rRNA-coding genes (size: 2584 bases) GC AT G C A T
Base content (bases) 1161 1423 665 496 554 869
Base content per 1 kb (bases) 449 551 257 192 214 336
Base content (%) 44.9% 55.1%
12S rRNA gene (size: 990 bases) GC AT G C A T
Base content (bases) 451 539 250 201 214 325
Base content per 1 kb (bases) 456 544 253 203 216 328
Base content (%) 45.6% 54.4%
16S rRNA gene (size: 1594 bases) GC AT G C A T
Base content (bases) 710 884 415 295 340 544
Base content per 1 kb (bases) 445 555 260 185 213 341
Base content (%) 44.5% 55.5%

ATP6 (size: 695 bases) GC AT G C A T
Base content (bases) 274 421 202 72 190 231
Base content per 1 kb (bases) 394 606 291 104 273 332
Base content (%) 39.4% 60.6%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 62 100 51 11 44 56
Base content per 1 kb (bases) 383 617 315 68 272 346
Base content (%) 38.3% 61.7%
COX1 (size: 1543 bases) GC AT G C A T
Base content (bases) 657 886 415 242 426 460
Base content per 1 kb (bases) 426 574 269 157 276 298
Base content (%) 42.6% 57.4%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 289 399 192 97 170 229
Base content per 1 kb (bases) 420 580 279 141 247 333
Base content (%) 42.0% 58.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 353 431 234 119 206 225
Base content per 1 kb (bases) 450 550 298 152 263 287
Base content (%) 45.0% 55.0%
CYTB (size: 1153 bases) GC AT G C A T
Base content (bases) 505 648 362 143 307 341
Base content per 1 kb (bases) 438 562 314 124 266 296
Base content (%) 43.8% 56.2%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 409 554 277 132 277 277
Base content per 1 kb (bases) 425 575 288 137 288 288
Base content (%) 42.5% 57.5%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 437 609 330 107 285 324
Base content per 1 kb (bases) 418 582 315 102 272 310
Base content (%) 41.8% 58.2%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 138 210 87 51 106 104
Base content per 1 kb (bases) 397 603 250 147 305 299
Base content (%) 39.7% 60.3%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 592 782 438 154 345 437
Base content per 1 kb (bases) 431 569 319 112 251 318
Base content (%) 43.1% 56.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 137 160 104 33 86 74
Base content per 1 kb (bases) 461 539 350 111 290 249
Base content (%) 46.1% 53.9%
ND5 (size: 1801 bases) GC AT G C A T
Base content (bases) 784 1017 551 233 455 562
Base content per 1 kb (bases) 435 565 306 129 253 312
Base content (%) 43.5% 56.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 232 296 181 51 91 205
Base content per 1 kb (bases) 439 561 343 97 172 388
Base content (%) 43.9% 56.1%

ATP6 (size: 695 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (2.61%)
Alanine (Ala, A)
n = 21 (9.13%)
Serine (Ser, S)
n = 13 (5.65%)
Threonine (Thr, T)
n = 26 (11.3%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.61%)
Leucine (Leu, L)
n = 59 (25.65%)
Isoleucine (Ile, I)
n = 22 (9.57%)
Methionine (Met, M)
n = 11 (4.78%)
Proline (Pro, P)
n = 16 (6.96%)
Phenylalanine (Phe, F)
n = 5 (2.17%)
Tyrosine (Tyr, Y)
n = 4 (1.74%)
Tryptophan (Trp, W)
n = 4 (1.74%)
Aspartic acid (Asp, D)
n = 2 (0.87%)
Glutamic acid (Glu, E)
n = 5 (2.17%)
Asparagine (Asn, N)
n = 11 (4.78%)
Glutamine (Gln, Q)
n = 7 (3.04%)
Histidine (His, H)
n = 4 (1.74%)
Lysine (Lys, K)
n = 5 (2.17%)
Arginine (Arg, R)
n = 4 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 8 8 5 6 28 2 15 7 0 1 0 4 1 5 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 12 5 1 0 0 5 1 1 4 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 2 2 6 1 1 1 2 3 1 0 3 5 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 1 5 0 0 0 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 72 78 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 73 38 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 57 114 45
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPKPWLMVFLTTWFMLIIATHPKIASLKFMNNPAPFHPTPIKPWPWPQI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.66%)
Serine (Ser, S)
n = 1 (1.89%)
Threonine (Thr, T)
n = 4 (7.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.89%)
Leucine (Leu, L)
n = 5 (9.43%)
Isoleucine (Ile, I)
n = 5 (9.43%)
Methionine (Met, M)
n = 4 (7.55%)
Proline (Pro, P)
n = 11 (20.75%)
Phenylalanine (Phe, F)
n = 4 (7.55%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.55%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.66%)
Glutamine (Gln, Q)
n = 2 (3.77%)
Histidine (His, H)
n = 2 (3.77%)
Lysine (Lys, K)
n = 4 (7.55%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 2 2 0 2 0 1 2 0 1 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 1 1 0 0 0 0 0 1 4 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 0 1 0 0 0 0 0 0 1 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 0 0 0 4 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 19 20 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 19 12 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 13 24 14
COX1 (size: 1543 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.58%)
Alanine (Ala, A)
n = 35 (6.82%)
Serine (Ser, S)
n = 34 (6.63%)
Threonine (Thr, T)
n = 40 (7.8%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.02%)
Leucine (Leu, L)
n = 55 (10.72%)
Isoleucine (Ile, I)
n = 38 (7.41%)
Methionine (Met, M)
n = 35 (6.82%)
Proline (Pro, P)
n = 31 (6.04%)
Phenylalanine (Phe, F)
n = 46 (8.97%)
Tyrosine (Tyr, Y)
n = 17 (3.31%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.73%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 18 (3.51%)
Glutamine (Gln, Q)
n = 11 (2.14%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 8 (1.56%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 32 5 16 20 4 10 10 1 7 8 16 5 14 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 7 11 17 0 1 6 26 11 4 7 20 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 17 1 5 6 16 1 1 5 9 8 1 0 6 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 1 3 11 8 0 1 2 5 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
138 112 145 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 169 221 96
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 12 (5.26%)
Serine (Ser, S)
n = 16 (7.02%)
Threonine (Thr, T)
n = 20 (8.77%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.14%)
Leucine (Leu, L)
n = 31 (13.6%)
Isoleucine (Ile, I)
n = 19 (8.33%)
Methionine (Met, M)
n = 13 (5.7%)
Proline (Pro, P)
n = 13 (5.7%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 10 (4.39%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 12 (5.26%)
Asparagine (Asn, N)
n = 7 (3.07%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 9 (3.95%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 10 2 7 14 2 6 6 3 1 3 10 0 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 4 7 0 2 1 5 1 1 0 9 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 2 5 6 0 0 3 4 6 1 0 0 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 1 3 7 4 0 1 3 0 1 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 61 66 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 61 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 73 102 39
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (6.54%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 15 (5.77%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 10 5 5 16 4 3 6 0 4 3 6 2 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 10 5 0 0 6 8 3 3 2 9 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 1 2 1 4 2 3 3 3 9 0 0 1 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 0 2 2 1 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 74 67 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 67 55 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 93 103 49
CYTB (size: 1153 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.27%)
Alanine (Ala, A)
n = 23 (6.01%)
Serine (Ser, S)
n = 26 (6.79%)
Threonine (Thr, T)
n = 26 (6.79%)
Cysteine (Cys, C)
n = 1 (0.26%)
Valine (Val, V)
n = 16 (4.18%)
Leucine (Leu, L)
n = 66 (17.23%)
Isoleucine (Ile, I)
n = 29 (7.57%)
Methionine (Met, M)
n = 22 (5.74%)
Proline (Pro, P)
n = 25 (6.53%)
Phenylalanine (Phe, F)
n = 25 (6.53%)
Tyrosine (Tyr, Y)
n = 15 (3.92%)
Tryptophan (Trp, W)
n = 13 (3.39%)
Aspartic acid (Asp, D)
n = 10 (2.61%)
Glutamic acid (Glu, E)
n = 6 (1.57%)
Asparagine (Asn, N)
n = 15 (3.92%)
Glutamine (Gln, Q)
n = 10 (2.61%)
Histidine (His, H)
n = 13 (3.39%)
Lysine (Lys, K)
n = 9 (2.35%)
Arginine (Arg, R)
n = 10 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 18 16 7 15 28 2 14 9 1 4 5 7 0 8 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 4 12 6 1 1 7 14 2 4 12 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 11 0 2 9 13 0 0 2 6 9 1 0 2 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 1 9 8 1 1 2 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 110 103 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 98 78 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 154 160 56
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 29 (9.06%)
Serine (Ser, S)
n = 24 (7.5%)
Threonine (Thr, T)
n = 29 (9.06%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.75%)
Leucine (Leu, L)
n = 63 (19.69%)
Isoleucine (Ile, I)
n = 25 (7.81%)
Methionine (Met, M)
n = 17 (5.31%)
Proline (Pro, P)
n = 17 (5.31%)
Phenylalanine (Phe, F)
n = 22 (6.88%)
Tyrosine (Tyr, Y)
n = 11 (3.44%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.13%)
Asparagine (Asn, N)
n = 10 (3.13%)
Glutamine (Gln, Q)
n = 6 (1.88%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 16 8 8 27 6 12 5 1 2 3 5 2 9 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 7 12 9 1 4 5 4 3 3 6 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 13 1 1 8 11 0 2 2 3 8 0 2 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 4 1 2 6 1 0 1 5 1 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 82 93 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 95 50 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 100 134 62
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.88%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 41 (11.82%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 32 (9.22%)
Methionine (Met, M)
n = 21 (6.05%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 18 (5.19%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 9 (2.59%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 18 19 9 12 30 5 12 9 0 2 2 3 1 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 8 14 9 1 2 5 3 0 2 10 6 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 2 2 13 10 0 0 5 3 5 2 1 1 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 2 1 0 12 1 0 1 3 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 92 124 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 117 53 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 121 146 62
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.88%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 41 (11.82%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 32 (9.22%)
Methionine (Met, M)
n = 21 (6.05%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 18 (5.19%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 9 (2.59%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 12 (3.46%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 13 (3.75%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 18 19 9 12 30 5 12 9 0 2 2 3 1 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 8 14 9 1 2 5 3 0 2 10 6 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 2 2 13 10 0 0 5 3 5 2 1 1 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 2 1 0 12 1 0 1 3 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 92 124 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 117 53 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 121 146 62
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.6%)
Alanine (Ala, A)
n = 29 (6.35%)
Serine (Ser, S)
n = 43 (9.41%)
Threonine (Thr, T)
n = 52 (11.38%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 16 (3.5%)
Leucine (Leu, L)
n = 94 (20.57%)
Isoleucine (Ile, I)
n = 30 (6.56%)
Methionine (Met, M)
n = 38 (8.32%)
Proline (Pro, P)
n = 22 (4.81%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 11 (2.41%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 7 (1.53%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 12 (2.63%)
Glutamine (Gln, Q)
n = 17 (3.72%)
Histidine (His, H)
n = 11 (2.41%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 19 30 13 23 40 2 15 16 1 2 3 11 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 4 3 19 7 0 0 8 11 2 2 5 15 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 26 1 4 16 14 1 1 7 6 5 2 1 5 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 0 2 5 8 0 1 2 6 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 137 148 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 138 74 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 163 215 61
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 12 (12.24%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 3 6 7 6 1 0 1 0 1 0 1 0 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 1 5 1 0 1 2 1 0 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 4 0 1 4 3 1 0 1 0 0 0 3 0 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 0 1 0 0 1 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
15 28 32 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 30 16 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 46 26 20
ND5 (size: 1801 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.51%)
Alanine (Ala, A)
n = 62 (10.35%)
Serine (Ser, S)
n = 49 (8.18%)
Threonine (Thr, T)
n = 45 (7.51%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 27 (4.51%)
Leucine (Leu, L)
n = 94 (15.69%)
Isoleucine (Ile, I)
n = 51 (8.51%)
Methionine (Met, M)
n = 37 (6.18%)
Proline (Pro, P)
n = 31 (5.18%)
Phenylalanine (Phe, F)
n = 34 (5.68%)
Tyrosine (Tyr, Y)
n = 18 (3.01%)
Tryptophan (Trp, W)
n = 8 (1.34%)
Aspartic acid (Asp, D)
n = 12 (2.0%)
Glutamic acid (Glu, E)
n = 13 (2.17%)
Asparagine (Asn, N)
n = 21 (3.51%)
Glutamine (Gln, Q)
n = 15 (2.5%)
Histidine (His, H)
n = 14 (2.34%)
Lysine (Lys, K)
n = 26 (4.34%)
Arginine (Arg, R)
n = 11 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 28 29 13 15 42 10 13 13 2 6 5 15 1 9 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 5 6 27 27 2 3 11 12 1 2 9 19 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 15 0 3 18 16 2 3 7 6 12 1 1 5 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 13 0 1 11 25 1 1 2 7 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
141 151 190 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 177 119 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 223 253 93
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.43%)
Alanine (Ala, A)
n = 13 (7.43%)
Serine (Ser, S)
n = 9 (5.14%)
Threonine (Thr, T)
n = 6 (3.43%)
Cysteine (Cys, C)
n = 5 (2.86%)
Valine (Val, V)
n = 27 (15.43%)
Leucine (Leu, L)
n = 29 (16.57%)
Isoleucine (Ile, I)
n = 6 (3.43%)
Methionine (Met, M)
n = 7 (4.0%)
Proline (Pro, P)
n = 1 (0.57%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 7 (4.0%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.14%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 5 (2.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 2 4 2 2 0 10 0 0 9 2 7 9 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 5 0 5 1 4 3 10 2 3 12 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 1 0 1 0 7 0 7 0 5 11 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 3 4 0 1 1 2 0 1 2 0 1 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 16 30 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 22 23 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 13 38 72
Total protein-coding genes (size: 11382 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 210 (5.54%)
Alanine (Ala, A)
n = 298 (7.86%)
Serine (Ser, S)
n = 275 (7.26%)
Threonine (Thr, T)
n = 334 (8.81%)
Cysteine (Cys, C)
n = 29 (0.77%)
Valine (Val, V)
n = 182 (4.8%)
Leucine (Leu, L)
n = 643 (16.97%)
Isoleucine (Ile, I)
n = 289 (7.63%)
Methionine (Met, M)
n = 230 (6.07%)
Proline (Pro, P)
n = 209 (5.51%)
Phenylalanine (Phe, F)
n = 224 (5.91%)
Tyrosine (Tyr, Y)
n = 115 (3.03%)
Tryptophan (Trp, W)
n = 101 (2.66%)
Aspartic acid (Asp, D)
n = 70 (1.85%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 126 (3.32%)
Glutamine (Gln, Q)
n = 95 (2.51%)
Histidine (His, H)
n = 100 (2.64%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
143 146 183 82 118 266 38 116 85 10 40 34 86 22 94 130
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
47 10 19 53 134 102 9 25 55 93 37 23 63 116 7 49
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
128 148 9 26 88 98 8 18 37 51 64 14 23 32 94 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
78 79 14 20 50 85 5 7 15 43 7 0 2 3 1 87
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
853 980 1126 832
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
469 1061 693 1568
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
253 1253 1590 695

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.