Viewing data for Ciconia ciconia


Scientific name Ciconia ciconia
Common name European white stork
Maximum lifespan 39.00 years (Ciconia ciconia@AnAge)

Total mtDNA (size: 17347 bases) GC AT G C A T
Base content (bases) 8038 9309 5548 2490 4012 5297
Base content per 1 kb (bases) 463 537 320 144 231 305
Base content (%) 46.3% 53.7%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5413 5965 3992 1421 2607 3358
Base content per 1 kb (bases) 476 524 351 125 229 295
Base content (%) 47.6% 52.4%
D-loop (size: 1779 bases) GC AT G C A T
Base content (bases) 721 1058 402 319 505 553
Base content per 1 kb (bases) 405 595 226 179 284 311
Base content (%) 40.5% 59.5%
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 663 887 399 264 378 509
Base content per 1 kb (bases) 428 572 257 170 244 328
Base content (%) 42.8% 57.2%
Total rRNA-coding genes (size: 2576 bases) GC AT G C A T
Base content (bases) 1207 1369 719 488 512 857
Base content per 1 kb (bases) 469 531 279 189 199 333
Base content (%) 46.9% 53.1%
12S rRNA gene (size: 968 bases) GC AT G C A T
Base content (bases) 467 501 276 191 190 311
Base content per 1 kb (bases) 482 518 285 197 196 321
Base content (%) 48.2% 51.8%
16S rRNA gene (size: 1608 bases) GC AT G C A T
Base content (bases) 740 868 443 297 322 546
Base content per 1 kb (bases) 460 540 275 185 200 340
Base content (%) 46.0% 54.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 314 370 243 71 164 206
Base content per 1 kb (bases) 459 541 355 104 240 301
Base content (%) 45.9% 54.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 59 11 41 57
Base content per 1 kb (bases) 417 583 351 65 244 339
Base content (%) 41.7% 58.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 737 814 494 243 381 433
Base content per 1 kb (bases) 475 525 319 157 246 279
Base content (%) 47.5% 52.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 315 369 213 102 161 208
Base content per 1 kb (bases) 461 539 311 149 235 304
Base content (%) 46.1% 53.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 372 412 255 117 195 217
Base content per 1 kb (bases) 474 526 325 149 249 277
Base content (%) 47.4% 52.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 578 565 425 153 272 293
Base content per 1 kb (bases) 506 494 372 134 238 256
Base content (%) 50.6% 49.4%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 450 528 323 127 256 272
Base content per 1 kb (bases) 460 540 330 130 262 278
Base content (%) 46.0% 54.0%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 472 569 370 102 240 329
Base content per 1 kb (bases) 453 547 355 98 231 316
Base content (%) 45.3% 54.7%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 169 182 129 40 85 97
Base content per 1 kb (bases) 481 519 368 114 242 276
Base content (%) 48.1% 51.9%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 652 729 518 134 304 425
Base content per 1 kb (bases) 472 528 375 97 220 308
Base content (%) 47.2% 52.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 143 154 105 38 73 81
Base content per 1 kb (bases) 481 519 354 128 246 273
Base content (%) 48.1% 51.9%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 881 931 663 218 376 555
Base content per 1 kb (bases) 486 514 366 120 208 306
Base content (%) 48.6% 51.4%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 265 257 198 67 63 194
Base content per 1 kb (bases) 508 492 379 128 121 372
Base content (%) 50.8% 49.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 15 9 4 14 36 0 5 7 1 1 4 2 1 0 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 3 9 4 0 1 4 3 1 1 6 9 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 2 1 3 5 0 0 5 1 2 0 0 2 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 2 1 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 88 71 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 64 33 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 91 102 27
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFYIMLATWLTLLLAIQPKLLSFTTTNQPSNKLPTTIKTTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 1 2 2 4 0 1 1 2 0 0 0 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 2 0 0 0 0 0 0 2 2 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 2 0 1 0 1 0 0 0 0 1 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 19 22 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 23 12 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 17 23 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 43 (8.33%)
Serine (Ser, S)
n = 26 (5.04%)
Threonine (Thr, T)
n = 44 (8.53%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (6.98%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 39 (7.56%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 32 (6.2%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 30 24 8 9 39 1 5 7 2 6 13 16 1 7 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 13 19 11 0 4 18 19 6 6 7 17 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 15 1 0 14 9 0 0 3 4 14 0 0 1 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 1 14 9 0 0 2 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 125 135 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 142 94 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 227 204 71
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 8 5 5 17 2 2 6 2 4 7 4 1 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 8 4 1 0 3 4 2 0 4 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 6 0 1 8 7 0 0 3 0 8 0 0 3 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 13 1 2 11 4 0 0 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 64 54 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 59 61 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 90 93 35
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 16 6 5 5 14 4 4 8 0 1 7 6 0 6 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 3 10 7 0 2 7 9 1 1 6 5 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 0 3 6 6 0 0 5 3 6 0 0 1 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 2 2 2 3 0 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 70 61 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 117 101 33
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 27 (7.11%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 31 (8.16%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 15 (3.95%)
Leucine (Leu, L)
n = 70 (18.42%)
Isoleucine (Ile, I)
n = 28 (7.37%)
Methionine (Met, M)
n = 6 (1.58%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 20 5 7 22 33 4 3 5 3 1 8 5 1 6 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 4 4 15 8 0 3 13 5 4 3 13 8 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 10 1 1 12 9 0 0 1 0 14 0 1 0 20 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 3 4 2 5 8 2 1 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 119 96 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 105 79 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 201 118 40
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 22 (6.77%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 13 (4.0%)
Leucine (Leu, L)
n = 63 (19.38%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 15 (4.62%)
Proline (Pro, P)
n = 26 (8.0%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 14 12 5 18 30 3 7 4 1 2 1 8 2 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 5 13 11 1 2 7 2 2 4 7 15 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 2 14 6 0 1 4 5 9 1 0 3 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 3 1 7 0 2 1 4 1 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 99 85 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 100 57 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 124 130 53
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 31 (8.96%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 47 (13.58%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 66 (19.08%)
Isoleucine (Ile, I)
n = 30 (8.67%)
Methionine (Met, M)
n = 19 (5.49%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 19 16 5 18 36 3 4 8 1 0 3 2 1 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 19 10 0 0 6 6 0 3 7 10 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 20 1 1 13 12 0 1 4 0 7 5 0 3 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 2 13 0 1 0 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 104 123 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 125 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 141 150 41
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 31 (8.96%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 47 (13.58%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 66 (19.08%)
Isoleucine (Ile, I)
n = 30 (8.67%)
Methionine (Met, M)
n = 19 (5.49%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 19 16 5 18 36 3 4 8 1 0 3 2 1 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 19 10 0 0 6 6 0 3 7 10 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 20 1 1 13 12 0 1 4 0 7 5 0 3 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 2 13 0 1 0 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 104 123 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 125 56 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 141 150 41
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.92%)
Alanine (Ala, A)
n = 31 (6.75%)
Serine (Ser, S)
n = 33 (7.19%)
Threonine (Thr, T)
n = 56 (12.2%)
Cysteine (Cys, C)
n = 3 (0.65%)
Valine (Val, V)
n = 6 (1.31%)
Leucine (Leu, L)
n = 104 (22.66%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 22 (4.79%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 13 (2.83%)
Tyrosine (Tyr, Y)
n = 12 (2.61%)
Tryptophan (Trp, W)
n = 12 (2.61%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 14 (3.05%)
Histidine (His, H)
n = 18 (3.92%)
Lysine (Lys, K)
n = 8 (1.74%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 36 20 9 34 51 6 4 14 0 0 2 4 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 7 14 10 0 3 7 6 2 1 16 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 26 1 3 11 11 0 1 7 3 9 1 0 1 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 7 3 0 2 8 0 0 2 9 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 171 153 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 140 80 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 207 192 46
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 5 1 4 14 1 2 2 0 0 0 2 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 0 6 5 0 1 3 1 0 0 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 3 3 3 0 0 2 1 1 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 33 20 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 43 43 11
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.64%)
Alanine (Ala, A)
n = 52 (8.62%)
Serine (Ser, S)
n = 45 (7.46%)
Threonine (Thr, T)
n = 81 (13.43%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 15 (2.49%)
Leucine (Leu, L)
n = 109 (18.08%)
Isoleucine (Ile, I)
n = 49 (8.13%)
Methionine (Met, M)
n = 23 (3.81%)
Proline (Pro, P)
n = 29 (4.81%)
Phenylalanine (Phe, F)
n = 29 (4.81%)
Tyrosine (Tyr, Y)
n = 12 (1.99%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 13 (2.16%)
Asparagine (Asn, N)
n = 25 (4.15%)
Glutamine (Gln, Q)
n = 21 (3.48%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 42 21 9 37 58 1 3 18 3 4 5 6 0 2 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 5 5 32 15 0 1 15 15 3 1 13 15 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
36 32 5 2 22 9 1 1 10 1 11 0 1 6 19 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 4 2 5 18 3 0 6 3 0 0 1 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
121 175 211 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 196 110 225
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 292 234 54
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 29 (16.76%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 12 (6.94%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 3 1 1 8 3 0 1 14 0 5 10 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 7 1 3 5 5 1 6 16 3 1 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 5 2 1 2 2 1 7 0 4 11 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 4 3 0 0 1 1 0 2 2 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 23 19 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 33 19 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 11 25 64
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.9%)
Alanine (Ala, A)
n = 303 (7.98%)
Serine (Ser, S)
n = 272 (7.16%)
Threonine (Thr, T)
n = 370 (9.74%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 161 (4.24%)
Leucine (Leu, L)
n = 680 (17.91%)
Isoleucine (Ile, I)
n = 291 (7.66%)
Methionine (Met, M)
n = 156 (4.11%)
Proline (Pro, P)
n = 225 (5.93%)
Phenylalanine (Phe, F)
n = 211 (5.56%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 126 (3.32%)
Glutamine (Gln, Q)
n = 100 (2.63%)
Histidine (His, H)
n = 109 (2.87%)
Lysine (Lys, K)
n = 83 (2.19%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
69 222 130 68 175 347 33 44 84 16 33 50 61 17 52 159
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 6 25 52 152 91 8 22 87 78 37 26 89 105 5 46
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
164 147 13 23 113 81 3 6 46 25 84 12 13 23 103 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
84 73 23 18 45 76 7 5 20 43 3 0 3 7 1 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
847 1128 1081 742
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
487 1118 694 1499
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
220 1618 1461 499

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.