Viewing data for Ursus thibetanus


Scientific name Ursus thibetanus
Common name Asiatic black bear
Maximum lifespan 39.20 years (Ursus thibetanus@AnAge)

Total mtDNA (size: 16795 bases) GC AT G C A T
Base content (bases) 6877 9917 4284 2593 4683 5234
Base content per 1 kb (bases) 409 590 255 154 279 312
Base content (%) 40.9% 59.0%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4679 6659 3073 1606 3243 3416
Base content per 1 kb (bases) 413 587 271 142 286 301
Base content (%) 41.3% 58.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1389 bases) GC AT G C A T
Base content (bases) 501 887 284 217 390 497
Base content per 1 kb (bases) 361 639 204 156 281 358
Base content (%) 36.1% 63.9%
Total rRNA-coding genes (size: 2541 bases) GC AT G C A T
Base content (bases) 1025 1516 558 467 601 915
Base content per 1 kb (bases) 403 597 220 184 237 360
Base content (%) 40.3% 59.7%
12S rRNA gene (size: 960 bases) GC AT G C A T
Base content (bases) 397 563 217 180 223 340
Base content per 1 kb (bases) 414 586 226 188 232 354
Base content (%) 41.4% 58.6%
16S rRNA gene (size: 1581 bases) GC AT G C A T
Base content (bases) 628 953 341 287 378 575
Base content per 1 kb (bases) 397 603 216 182 239 364
Base content (%) 39.7% 60.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 282 399 180 102 216 183
Base content per 1 kb (bases) 414 586 264 150 317 269
Base content (%) 41.4% 58.6%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 71 130 53 18 53 77
Base content per 1 kb (bases) 353 647 264 90 264 383
Base content (%) 35.3% 64.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 651 894 358 293 492 402
Base content per 1 kb (bases) 421 579 232 190 318 260
Base content (%) 42.1% 57.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 267 417 159 108 194 223
Base content per 1 kb (bases) 390 610 232 158 284 326
Base content (%) 39.0% 61.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 339 445 208 131 239 206
Base content per 1 kb (bases) 432 568 265 167 305 263
Base content (%) 43.2% 56.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 524 616 356 168 291 325
Base content per 1 kb (bases) 460 540 312 147 255 285
Base content (%) 46.0% 54.0%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 411 544 276 135 270 274
Base content per 1 kb (bases) 430 570 289 141 283 287
Base content (%) 43.0% 57.0%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 409 633 300 109 280 353
Base content per 1 kb (bases) 393 607 288 105 269 339
Base content (%) 39.3% 60.7%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 144 203 95 49 102 101
Base content per 1 kb (bases) 415 585 274 141 294 291
Base content (%) 41.5% 58.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 574 804 389 185 395 409
Base content per 1 kb (bases) 417 583 282 134 287 297
Base content (%) 41.7% 58.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 114 183 72 42 101 82
Base content per 1 kb (bases) 384 616 242 141 340 276
Base content (%) 38.4% 61.6%
ND5 (size: 1819 bases) GC AT G C A T
Base content (bases) 717 1102 491 226 522 580
Base content per 1 kb (bases) 394 606 270 124 287 319
Base content (%) 39.4% 60.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 196 332 150 46 109 223
Base content per 1 kb (bases) 371 629 284 87 206 422
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.19%)
Leucine (Leu, L)
n = 41 (18.14%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 9 4 3 4 17 5 7 7 1 4 3 4 3 8 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 0 5 7 4 0 3 1 4 3 7 3 1 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 1 3 3 4 0 3 3 1 2 0 5 6 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 1 1 3 1 1 1 3 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 62 77 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 63 35 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 55 71 71
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWSITILSMVLALFIMFQLKISKYKYPETPEPKSPSSSKKLMPWEEKWTKIYSPLLLPR*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 9 (13.64%)
Threonine (Thr, T)
n = 5 (7.58%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 9 (13.64%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 8 (12.12%)
Phenylalanine (Phe, F)
n = 2 (3.03%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 4 (6.06%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 2 (3.03%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 8 (12.12%)
Arginine (Arg, R)
n = 1 (1.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 3 2 0 4 0 3 1 1 1 0 0 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 3 3 1 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 2 1 6 0 0 0 2 1 0 0 0 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 0 1 5 3 0 0 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 17 22 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 23 19 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 13 36 11
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 35 (6.81%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 37 (7.2%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 13 28 10 5 19 13 5 4 2 7 11 12 8 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 0 12 11 14 4 7 9 18 13 14 5 9 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 1 14 2 10 2 0 3 10 9 2 6 12 6 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 3 7 7 7 2 1 0 5 2 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 107 139 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 95 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
67 119 168 161
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 10 (4.41%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 5 (2.2%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 13 3 5 13 5 6 6 1 3 1 6 2 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 3 2 5 0 1 3 4 0 2 4 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 2 4 3 6 2 2 2 7 4 2 2 4 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 4 6 4 5 0 1 0 3 2 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 59 67 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 45 94 61
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 24 (9.23%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 5 9 11 2 15 2 1 5 2 3 5 7 2 10 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 4 8 2 2 5 9 3 0 5 5 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 0 4 3 10 1 2 4 8 3 0 1 1 4 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 4 3 0 1 1 0 1 1 3 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 70 58 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 67 53 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 71 95 71
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 30 (7.92%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 23 (6.07%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 29 7 3 13 35 4 3 4 2 3 4 7 1 11 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 4 12 11 3 0 7 18 1 1 12 9 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 1 3 8 10 2 0 2 5 9 0 2 1 14 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 2 2 10 7 2 0 0 7 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 105 103 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 99 75 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 152 147 55
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 32 (10.09%)
Serine (Ser, S)
n = 19 (5.99%)
Threonine (Thr, T)
n = 24 (7.57%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 19 (5.99%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 22 (6.94%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 10 11 7 8 28 8 4 5 1 2 6 11 0 5 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 7 12 12 1 3 2 5 2 5 11 5 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 1 2 3 12 0 0 2 6 6 0 0 7 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 8 3 1 2 7 0 2 1 4 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 91 87 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 95 56 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 90 131 71
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 25 (7.23%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 30 (8.67%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.34%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 33 (9.54%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 23 27 7 8 30 3 8 7 1 3 6 6 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 2 12 11 0 0 9 4 3 6 8 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 19 0 2 10 13 0 0 3 5 3 0 1 5 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 1 14 0 1 0 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 89 130 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 103 58 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 108 165 60
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 25 (7.23%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 30 (8.67%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.34%)
Leucine (Leu, L)
n = 57 (16.47%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 33 (9.54%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 23 27 7 8 30 3 8 7 1 3 6 6 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 2 12 11 0 0 9 4 3 6 8 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 19 0 2 10 13 0 0 3 5 3 0 1 5 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 1 14 0 1 0 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 89 130 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 103 58 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 108 165 60
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 34 (7.42%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 35 (7.64%)
Methionine (Met, M)
n = 33 (7.21%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 18 (3.93%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 19 27 15 13 45 10 8 8 3 2 4 9 3 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 2 6 13 11 4 2 7 7 2 6 11 6 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 1 8 10 6 0 6 7 8 8 3 4 7 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 2 2 3 8 5 0 1 9 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 136 151 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 120 80 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 133 178 105
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 11 (11.22%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 7 (7.14%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 5 3 1 11 3 4 2 0 1 4 5 1 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 3 2 2 0 1 0 2 1 1 1 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 1 5 1 0 0 0 2 2 0 0 5 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 25 25 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 21 19 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 26 38 26
ND5 (size: 1819 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 46 (7.6%)
Serine (Ser, S)
n = 43 (7.11%)
Threonine (Thr, T)
n = 57 (9.42%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 25 (4.13%)
Leucine (Leu, L)
n = 84 (13.88%)
Isoleucine (Ile, I)
n = 56 (9.26%)
Methionine (Met, M)
n = 38 (6.28%)
Proline (Pro, P)
n = 24 (3.97%)
Phenylalanine (Phe, F)
n = 46 (7.6%)
Tyrosine (Tyr, Y)
n = 19 (3.14%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 32 (5.29%)
Glutamine (Gln, Q)
n = 21 (3.47%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 24 (3.97%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 29 34 14 14 39 4 11 18 3 3 8 14 0 17 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 9 18 17 2 1 6 16 6 8 5 10 1 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 22 2 8 13 8 3 5 6 10 9 1 2 20 12 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 4 2 9 17 7 1 3 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
122 140 218 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 159 133 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 192 229 146
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 7 (4.0%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 20 (11.43%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 5 (2.86%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 1 2 3 0 2 1 10 0 1 10 3 7 5 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 5 1 0 2 9 0 3 12 2 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 0 2 7 0 1 0 4 0 9 0 3 4 5 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 1 2 2 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 11 44 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 26 33 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 9 32 90
Total protein-coding genes (size: 11401 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.72%)
Alanine (Ala, A)
n = 281 (7.4%)
Serine (Ser, S)
n = 277 (7.3%)
Threonine (Thr, T)
n = 292 (7.69%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 213 (5.61%)
Leucine (Leu, L)
n = 595 (15.67%)
Isoleucine (Ile, I)
n = 315 (8.3%)
Methionine (Met, M)
n = 236 (6.22%)
Proline (Pro, P)
n = 199 (5.24%)
Phenylalanine (Phe, F)
n = 236 (6.22%)
Tyrosine (Tyr, Y)
n = 132 (3.48%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 72 (1.9%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 145 (3.82%)
Glutamine (Gln, Q)
n = 87 (2.29%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 102 (2.69%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
159 156 175 84 78 271 60 75 69 18 42 56 90 25 111 125
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
61 7 18 60 99 103 19 30 49 91 47 56 72 63 8 84
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
71 124 13 58 63 89 11 23 33 76 56 12 27 75 70 48
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
50 68 30 30 42 79 23 8 8 41 10 1 0 5 1 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
881 944 1147 826
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
470 993 740 1595
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
365 1046 1436 951

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.