Viewing data for Balearica regulorum


Scientific name Balearica regulorum
Common name Grey crowned crane
Maximum lifespan 27.20 years (Balearica regulorum@AnAge)

Total mtDNA (size: 16802 bases) GC AT G C A T
Base content (bases) 7547 9255 5252 2295 3964 5291
Base content per 1 kb (bases) 449 551 313 137 236 315
Base content (%) 44.9% 55.1%
Total protein-coding genes (size: 11355 bases) GC AT G C A T
Base content (bases) 5165 6190 3789 1376 2699 3491
Base content per 1 kb (bases) 455 545 334 121 238 307
Base content (%) 45.5% 54.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1552 bases) GC AT G C A T
Base content (bases) 667 885 403 264 374 511
Base content per 1 kb (bases) 430 570 260 170 241 329
Base content (%) 43.0% 57.0%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1204 1368 715 489 512 856
Base content per 1 kb (bases) 468 532 278 190 199 333
Base content (%) 46.8% 53.2%
12S rRNA gene (size: 976 bases) GC AT G C A T
Base content (bases) 472 504 278 194 197 307
Base content per 1 kb (bases) 484 516 285 199 202 315
Base content (%) 48.4% 51.6%
16S rRNA gene (size: 1596 bases) GC AT G C A T
Base content (bases) 732 864 437 295 315 549
Base content per 1 kb (bases) 459 541 274 185 197 344
Base content (%) 45.9% 54.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 309 375 247 62 157 218
Base content per 1 kb (bases) 452 548 361 91 230 319
Base content (%) 45.2% 54.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 74 94 66 8 39 55
Base content per 1 kb (bases) 440 560 393 48 232 327
Base content (%) 44.0% 56.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 719 832 473 246 394 438
Base content per 1 kb (bases) 464 536 305 159 254 282
Base content (%) 46.4% 53.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 312 372 215 97 162 210
Base content per 1 kb (bases) 456 544 314 142 237 307
Base content (%) 45.6% 54.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 375 409 254 121 190 219
Base content per 1 kb (bases) 478 522 324 154 242 279
Base content (%) 47.8% 52.2%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 537 606 403 134 273 333
Base content per 1 kb (bases) 470 530 353 117 239 291
Base content (%) 47.0% 53.0%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 446 520 316 130 257 263
Base content per 1 kb (bases) 462 538 327 135 266 272
Base content (%) 46.2% 53.8%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 446 593 344 102 259 334
Base content per 1 kb (bases) 429 571 331 98 249 321
Base content (%) 42.9% 57.1%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 161 191 122 39 88 103
Base content per 1 kb (bases) 457 543 347 111 250 293
Base content (%) 45.7% 54.3%
ND4 (size: 1368 bases) GC AT G C A T
Base content (bases) 604 764 466 138 327 437
Base content per 1 kb (bases) 442 558 341 101 239 319
Base content (%) 44.2% 55.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 137 160 99 38 70 90
Base content per 1 kb (bases) 461 539 333 128 236 303
Base content (%) 46.1% 53.9%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 800 1015 587 213 429 586
Base content per 1 kb (bases) 441 559 323 117 236 323
Base content (%) 44.1% 55.9%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 249 273 199 50 59 214
Base content per 1 kb (bases) 477 523 381 96 113 410
Base content (%) 47.7% 52.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 60 (26.43%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 17 10 6 15 32 1 6 7 1 0 3 3 0 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 3 7 4 0 1 3 4 0 0 6 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 0 0 4 5 2 0 4 1 2 0 0 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 3 1 1 2 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
33 88 74 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 67 35 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 92 109 20
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFLIMLTSWLTFSLIIQPKLLPFTPTNSPSSSPTMTTKTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 11 (20.0%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 2 1 2 3 0 1 2 0 0 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 2 4 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 2 0 0 3 2 0 0 1 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 18 23 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 26 8 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 22 24 8
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 41 (7.95%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.4%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 42 (8.14%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 44 (8.53%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 29 20 5 7 38 2 8 9 0 1 12 17 3 6 38
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 11 22 12 0 6 16 22 3 3 8 18 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 16 0 6 10 8 0 0 3 5 12 1 1 3 12 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 1 5 10 9 0 1 1 6 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 119 136 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 141 94 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 213 208 77
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 14 8 3 9 17 1 2 7 0 4 5 4 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 5 4 6 0 0 2 5 1 3 4 5 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 6 0 1 8 7 0 0 2 1 7 0 0 0 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 2 4 9 4 0 0 2 1 2 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 64 57 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 59 62 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 92 91 35
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 19 (7.31%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 8 (3.08%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 19 (7.31%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 7 2 6 17 2 5 8 0 5 2 6 0 2 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 3 9 8 1 2 8 9 2 1 6 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 1 1 6 8 0 1 3 2 6 2 0 0 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 7 1 1 3 3 0 0 0 4 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 72 57 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 115 107 28
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.84%)
Alanine (Ala, A)
n = 23 (6.05%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 32 (8.42%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 14 (3.68%)
Leucine (Leu, L)
n = 66 (17.37%)
Isoleucine (Ile, I)
n = 27 (7.11%)
Methionine (Met, M)
n = 14 (3.68%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 29 (7.63%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 13 (3.42%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 25 12 4 21 37 1 3 8 0 2 4 7 1 2 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 3 14 6 0 3 13 10 0 3 6 14 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 10 0 4 7 10 1 0 1 2 11 0 0 3 18 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 1 1 5 10 0 1 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 117 105 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 102 79 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 184 149 40
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.05%)
Alanine (Ala, A)
n = 29 (9.03%)
Serine (Ser, S)
n = 29 (9.03%)
Threonine (Thr, T)
n = 20 (6.23%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.43%)
Leucine (Leu, L)
n = 64 (19.94%)
Isoleucine (Ile, I)
n = 26 (8.1%)
Methionine (Met, M)
n = 13 (4.05%)
Proline (Pro, P)
n = 25 (7.79%)
Phenylalanine (Phe, F)
n = 17 (5.3%)
Tyrosine (Tyr, Y)
n = 15 (4.67%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.43%)
Asparagine (Asn, N)
n = 12 (3.74%)
Glutamine (Gln, Q)
n = 5 (1.56%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 8 (2.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 18 10 8 16 29 3 7 4 1 2 1 8 0 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 6 10 12 1 2 6 1 4 6 7 9 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 7 1 4 9 10 0 0 6 5 10 2 1 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 3 1 3 5 2 1 2 5 0 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 97 85 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 97 57 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 122 121 54
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 29 (8.41%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 15 (4.35%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.06%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 17 13 7 17 31 2 7 8 2 2 1 6 0 5 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 11 12 1 1 5 4 2 2 9 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 24 0 5 7 11 2 1 2 1 5 3 1 2 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 0 11 2 0 1 2 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 100 126 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 121 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 123 149 56
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 29 (8.41%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 15 (4.35%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 15 (4.35%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.06%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 17 13 7 17 31 2 7 8 2 2 1 6 0 5 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 11 12 1 1 5 4 2 2 9 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 24 0 5 7 11 2 1 2 1 5 3 1 2 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 0 11 2 0 1 2 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 100 126 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 121 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 123 149 56
ND4 (size: 1368 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.18%)
Alanine (Ala, A)
n = 31 (6.81%)
Serine (Ser, S)
n = 32 (7.03%)
Threonine (Thr, T)
n = 55 (12.09%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.98%)
Leucine (Leu, L)
n = 95 (20.88%)
Isoleucine (Ile, I)
n = 37 (8.13%)
Methionine (Met, M)
n = 27 (5.93%)
Proline (Pro, P)
n = 28 (6.15%)
Phenylalanine (Phe, F)
n = 19 (4.18%)
Tyrosine (Tyr, Y)
n = 11 (2.42%)
Tryptophan (Trp, W)
n = 12 (2.64%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.98%)
Asparagine (Asn, N)
n = 13 (2.86%)
Glutamine (Gln, Q)
n = 16 (3.52%)
Histidine (His, H)
n = 18 (3.96%)
Lysine (Lys, K)
n = 9 (1.98%)
Arginine (Arg, R)
n = 10 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 24 24 4 24 45 1 17 15 1 1 3 5 0 3 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 2 15 14 0 4 7 6 2 2 9 17 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 21 0 1 12 9 1 2 7 2 9 1 4 2 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 1 0 2 9 0 2 2 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 146 151 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 137 78 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 183 208 51
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 6 0 2 16 0 1 2 0 0 1 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 2 3 3 1 0 3 1 0 0 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 1 4 3 1 0 4 0 2 1 0 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 0 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 31 27 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 39 45 10
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 35 (5.79%)
Alanine (Ala, A)
n = 47 (7.78%)
Serine (Ser, S)
n = 46 (7.62%)
Threonine (Thr, T)
n = 74 (12.25%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 14 (2.32%)
Leucine (Leu, L)
n = 101 (16.72%)
Isoleucine (Ile, I)
n = 53 (8.77%)
Methionine (Met, M)
n = 35 (5.79%)
Proline (Pro, P)
n = 28 (4.64%)
Phenylalanine (Phe, F)
n = 33 (5.46%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 13 (2.15%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 14 (2.32%)
Asparagine (Asn, N)
n = 25 (4.14%)
Glutamine (Gln, Q)
n = 18 (2.98%)
Histidine (His, H)
n = 14 (2.32%)
Lysine (Lys, K)
n = 25 (4.14%)
Arginine (Arg, R)
n = 7 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 35 32 9 30 42 5 14 17 1 3 4 7 0 5 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 8 26 13 0 1 16 9 9 0 9 19 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 31 2 5 15 12 4 2 8 3 10 2 1 5 20 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 13 1 3 3 24 1 1 3 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 153 222 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 185 116 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 249 248 79
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 11 (6.36%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 32 (18.5%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 6 (3.47%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 3 0 0 2 4 0 0 14 0 5 13 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 2 0 3 6 3 0 2 22 3 0 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 8 0 0 2 3 0 5 3 3 17 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 2 2 0 0 2 0 0 3 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 15 20 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 29 19 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
79 6 20 69
Total protein-coding genes (size: 11372 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 225 (5.94%)
Alanine (Ala, A)
n = 280 (7.39%)
Serine (Ser, S)
n = 277 (7.31%)
Threonine (Thr, T)
n = 362 (9.55%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 157 (4.14%)
Leucine (Leu, L)
n = 655 (17.29%)
Isoleucine (Ile, I)
n = 299 (7.89%)
Methionine (Met, M)
n = 182 (4.8%)
Proline (Pro, P)
n = 224 (5.91%)
Phenylalanine (Phe, F)
n = 226 (5.96%)
Tyrosine (Tyr, Y)
n = 106 (2.8%)
Tryptophan (Trp, W)
n = 109 (2.88%)
Aspartic acid (Asp, D)
n = 60 (1.58%)
Glutamic acid (Glu, E)
n = 95 (2.51%)
Asparagine (Asn, N)
n = 131 (3.46%)
Glutamine (Gln, Q)
n = 97 (2.56%)
Histidine (His, H)
n = 116 (3.06%)
Lysine (Lys, K)
n = 87 (2.3%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
89 210 149 55 157 321 21 76 91 6 34 36 70 17 51 175
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 8 15 51 122 96 11 23 81 75 46 27 70 116 11 55
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
155 147 5 38 88 87 13 9 42 27 79 15 25 21 110 24
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
92 81 14 18 42 81 6 9 17 36 6 1 2 8 0 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
817 1059 1115 799
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
479 1092 700 1519
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
231 1491 1529 539

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.