Viewing data for Acipenser dabryanus


Scientific name Acipenser dabryanus
Common name Yangtze sturgeon
Maximum lifespan 100.00 years (Acipenser dabryanus@AnAge)

Total mtDNA (size: 16438 bases) GC AT G C A T
Base content (bases) 7578 8860 4877 2701 3900 4960
Base content per 1 kb (bases) 461 539 297 164 237 302
Base content (%) 46.1% 53.9%
Total protein-coding genes (size: 11413 bases) GC AT G C A T
Base content (bases) 5350 6063 3632 1718 2774 3289
Base content per 1 kb (bases) 469 531 318 151 243 288
Base content (%) 46.9% 53.1%
D-loop (size: 726 bases) GC AT G C A T
Base content (bases) 277 449 162 115 208 241
Base content per 1 kb (bases) 382 618 223 158 287 332
Base content (%) 38.2% 61.8%
Total tRNA-coding genes (size: 1557 bases) GC AT G C A T
Base content (bases) 680 877 373 307 394 483
Base content per 1 kb (bases) 437 563 240 197 253 310
Base content (%) 43.7% 56.3%
Total rRNA-coding genes (size: 2661 bases) GC AT G C A T
Base content (bases) 1227 1434 684 543 510 924
Base content per 1 kb (bases) 461 539 257 204 192 347
Base content (%) 46.1% 53.9%
12S rRNA gene (size: 960 bases) GC AT G C A T
Base content (bases) 473 487 266 207 178 309
Base content per 1 kb (bases) 493 507 277 216 185 322
Base content (%) 49.3% 50.7%
16S rRNA gene (size: 1701 bases) GC AT G C A T
Base content (bases) 754 947 418 336 332 615
Base content per 1 kb (bases) 443 557 246 198 195 362
Base content (%) 44.3% 55.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 328 356 238 90 172 184
Base content per 1 kb (bases) 480 520 348 132 251 269
Base content (%) 48.0% 52.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 67 101 51 16 42 59
Base content per 1 kb (bases) 399 601 304 95 250 351
Base content (%) 39.9% 60.1%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 746 808 445 301 426 382
Base content per 1 kb (bases) 480 520 286 194 274 246
Base content (%) 48.0% 52.0%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 317 374 191 126 169 205
Base content per 1 kb (bases) 459 541 276 182 245 297
Base content (%) 45.9% 54.1%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 380 406 246 134 195 211
Base content per 1 kb (bases) 483 517 313 170 248 268
Base content (%) 48.3% 51.7%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 526 615 357 169 300 315
Base content per 1 kb (bases) 461 539 313 148 263 276
Base content (%) 46.1% 53.9%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 460 515 321 139 244 271
Base content per 1 kb (bases) 472 528 329 143 250 278
Base content (%) 47.2% 52.8%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 487 558 350 137 226 332
Base content per 1 kb (bases) 466 534 335 131 216 318
Base content (%) 46.6% 53.4%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 166 183 111 55 96 87
Base content per 1 kb (bases) 476 524 318 158 275 249
Base content (%) 47.6% 52.4%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 646 735 439 207 335 400
Base content per 1 kb (bases) 468 532 318 150 243 290
Base content (%) 46.8% 53.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 150 147 105 45 75 72
Base content per 1 kb (bases) 505 495 354 152 253 242
Base content (%) 50.5% 49.5%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 836 1006 596 240 441 565
Base content per 1 kb (bases) 454 546 324 130 239 307
Base content (%) 45.4% 54.6%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 247 275 186 61 59 216
Base content per 1 kb (bases) 473 527 356 117 113 414
Base content (%) 47.3% 52.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 5 6 16 20 6 7 8 1 3 4 7 1 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 8 7 0 0 7 4 0 2 11 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 8 1 0 1 1 0 0 5 0 3 0 1 0 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 1 0 0 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 84 66 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 59 33 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 95 85 34
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFMILIFSWLIFLIILPPKVLGHTFTNEPTHKNAEKIKPEPWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 1 1 0 4 0 1 1 0 0 0 0 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 2 4 2 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 1 0 1 1 0 0 0 0 0 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 20 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 16 15 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 24 10
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 48 (9.28%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 36 (6.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.51%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 37 (7.16%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 18 13 8 8 24 11 9 6 2 5 12 17 10 20 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 7 29 9 3 4 20 17 6 5 12 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 2 4 10 9 2 0 4 11 8 2 2 5 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 4 4 11 7 1 3 1 3 1 0 0 0 1 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
164 114 125 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 137 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
60 194 162 102
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 15 (6.55%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 11 (4.8%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 5 4 5 11 5 3 8 0 2 5 7 6 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 1 7 4 3 0 3 4 2 1 4 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 1 4 5 5 0 1 2 4 6 1 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 13 3 1 11 4 0 0 1 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 63 53 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 74 87 40
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 24 (9.2%)
Serine (Ser, S)
n = 12 (4.6%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.51%)
Leucine (Leu, L)
n = 31 (11.88%)
Isoleucine (Ile, I)
n = 15 (5.75%)
Methionine (Met, M)
n = 9 (3.45%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 15 (5.75%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 6 6 7 11 3 3 9 0 1 9 7 0 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 1 11 10 2 0 8 8 4 1 5 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 1 3 3 3 0 0 3 2 10 0 1 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 1 1 4 2 0 0 2 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 69 54 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 109 101 37
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 24 (6.33%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 28 (7.39%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 18 8 8 17 18 5 8 7 2 1 7 11 5 13 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 3 17 8 0 1 10 16 1 2 9 10 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 0 4 9 8 0 0 1 4 9 1 2 5 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 0 2 9 9 0 0 0 7 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 99 95 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 96 79 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 162 141 56
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 35 (10.8%)
Serine (Ser, S)
n = 19 (5.86%)
Threonine (Thr, T)
n = 19 (5.86%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.7%)
Leucine (Leu, L)
n = 60 (18.52%)
Isoleucine (Ile, I)
n = 28 (8.64%)
Methionine (Met, M)
n = 14 (4.32%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 14 (4.32%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 21 11 1 17 26 6 8 5 1 1 2 8 1 7 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 17 13 1 1 11 4 2 3 9 12 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 6 0 4 7 5 1 1 1 6 8 3 2 4 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 1 0 4 7 0 0 1 7 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 93 83 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 95 61 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 133 127 43
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 26 (7.49%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 8 (2.31%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 16 21 9 12 29 7 6 11 3 0 3 2 1 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 2 22 12 1 2 7 6 2 0 10 6 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 19 2 1 8 9 0 3 5 3 6 3 0 2 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 1 0 1 8 2 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 98 130 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 121 56 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 131 146 42
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 26 (7.49%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 8 (2.31%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 11 (3.17%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 16 21 9 12 29 7 6 11 3 0 3 2 1 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 2 22 12 1 2 7 6 2 0 10 6 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 19 2 1 8 9 0 3 5 3 6 3 0 2 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 1 0 1 8 2 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 98 130 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 121 56 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 131 146 42
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (5.88%)
Alanine (Ala, A)
n = 40 (8.71%)
Serine (Ser, S)
n = 29 (6.32%)
Threonine (Thr, T)
n = 42 (9.15%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 26 (5.66%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 9 (1.96%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 19 17 13 16 37 11 8 11 1 4 3 6 3 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 4 6 19 15 0 2 9 12 4 3 12 12 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 14 3 0 13 10 0 1 5 2 12 3 1 1 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 2 0 4 9 1 0 2 9 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 136 139 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 132 74 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 171 187 64
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 4 3 8 9 1 2 3 0 0 0 2 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 7 2 1 0 1 4 1 1 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 2 2 3 2 0 0 2 0 1 0 1 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 33 21 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 42 35 14
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.22%)
Alanine (Ala, A)
n = 50 (8.16%)
Serine (Ser, S)
n = 44 (7.18%)
Threonine (Thr, T)
n = 68 (11.09%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 24 (3.92%)
Leucine (Leu, L)
n = 95 (15.5%)
Isoleucine (Ile, I)
n = 53 (8.65%)
Methionine (Met, M)
n = 27 (4.4%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 39 (6.36%)
Tyrosine (Tyr, Y)
n = 11 (1.79%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 13 (2.12%)
Glutamic acid (Glu, E)
n = 11 (1.79%)
Asparagine (Asn, N)
n = 27 (4.4%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 22 (3.59%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 32 21 9 24 40 10 12 20 2 5 6 8 5 13 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 4 3 32 14 1 5 9 14 4 2 13 13 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
30 26 1 4 13 13 0 3 11 3 8 2 0 3 24 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 1 1 12 22 0 1 2 5 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
130 160 211 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 178 123 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 258 231 90
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 29 (16.76%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 12 (6.94%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 5 1 0 3 8 0 0 11 1 3 14 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 8 0 2 7 7 0 3 14 2 2 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 5 1 1 3 2 0 8 1 4 14 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 5 0 0 1 2 0 0 2 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 18 16 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 35 22 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 8 21 75
Total protein-coding genes (size: 11435 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.46%)
Alanine (Ala, A)
n = 336 (8.82%)
Serine (Ser, S)
n = 234 (6.14%)
Threonine (Thr, T)
n = 319 (8.37%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 214 (5.62%)
Leucine (Leu, L)
n = 627 (16.46%)
Isoleucine (Ile, I)
n = 289 (7.59%)
Methionine (Met, M)
n = 173 (4.54%)
Proline (Pro, P)
n = 215 (5.64%)
Phenylalanine (Phe, F)
n = 221 (5.8%)
Tyrosine (Tyr, Y)
n = 117 (3.07%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 76 (2.0%)
Glutamic acid (Glu, E)
n = 101 (2.65%)
Asparagine (Asn, N)
n = 125 (3.28%)
Glutamine (Gln, Q)
n = 104 (2.73%)
Histidine (His, H)
n = 103 (2.7%)
Lysine (Lys, K)
n = 79 (2.07%)
Arginine (Arg, R)
n = 74 (1.94%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
139 150 114 78 134 242 70 79 91 13 33 55 79 47 95 126
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
59 10 19 39 173 104 20 22 88 95 41 26 96 85 8 33
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
146 126 14 32 78 68 6 11 39 44 73 21 24 25 100 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
86 84 17 15 61 74 5 7 13 49 5 0 0 5 3 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
973 1020 1035 782
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
519 1054 713 1524
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
353 1437 1394 626

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.