Viewing data for Carollia perspicillata


Scientific name Carollia perspicillata
Common name Seba's short-tailed bat
Maximum lifespan 17.00 years (Carollia perspicillata@AnAge)

Total mtDNA (size: 16711 bases) GC AT G C A T
Base content (bases) 6926 9785 4635 2291 4526 5259
Base content per 1 kb (bases) 414 586 277 137 271 315
Base content (%) 41.4% 58.6%
Total protein-coding genes (size: 11344 bases) GC AT G C A T
Base content (bases) 4683 6661 3321 1362 3168 3493
Base content per 1 kb (bases) 413 587 293 120 279 308
Base content (%) 41.3% 58.7%
D-loop (size: 1275 bases) GC AT G C A T
Base content (bases) 579 696 363 216 335 361
Base content per 1 kb (bases) 454 546 285 169 263 283
Base content (%) 45.4% 54.6%
Total tRNA-coding genes (size: 1517 bases) GC AT G C A T
Base content (bases) 586 931 339 247 413 518
Base content per 1 kb (bases) 386 614 223 163 272 341
Base content (%) 38.6% 61.4%
Total rRNA-coding genes (size: 2535 bases) GC AT G C A T
Base content (bases) 1055 1480 598 457 600 880
Base content per 1 kb (bases) 416 584 236 180 237 347
Base content (%) 41.6% 58.4%
12S rRNA gene (size: 970 bases) GC AT G C A T
Base content (bases) 420 550 242 178 221 329
Base content per 1 kb (bases) 433 567 249 184 228 339
Base content (%) 43.3% 56.7%
16S rRNA gene (size: 1565 bases) GC AT G C A T
Base content (bases) 635 930 356 279 379 551
Base content per 1 kb (bases) 406 594 227 178 242 352
Base content (%) 40.6% 59.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 266 415 186 80 213 202
Base content per 1 kb (bases) 391 609 273 117 313 297
Base content (%) 39.1% 60.9%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 69 135 53 16 60 75
Base content per 1 kb (bases) 338 662 260 78 294 368
Base content (%) 33.8% 66.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 641 904 391 250 487 417
Base content per 1 kb (bases) 415 585 253 162 315 270
Base content (%) 41.5% 58.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 282 402 186 96 192 210
Base content per 1 kb (bases) 412 588 272 140 281 307
Base content (%) 41.2% 58.8%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 349 436 229 120 220 216
Base content per 1 kb (bases) 445 555 292 153 280 275
Base content (%) 44.5% 55.5%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 491 649 331 160 327 322
Base content per 1 kb (bases) 431 569 290 140 287 282
Base content (%) 43.1% 56.9%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 407 550 295 112 249 301
Base content per 1 kb (bases) 425 575 308 117 260 315
Base content (%) 42.5% 57.5%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 418 626 338 80 259 367
Base content per 1 kb (bases) 400 600 324 77 248 352
Base content (%) 40.0% 60.0%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 153 195 103 50 93 102
Base content per 1 kb (bases) 440 560 296 144 267 293
Base content (%) 44.0% 56.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 557 821 411 146 403 418
Base content per 1 kb (bases) 404 596 298 106 292 303
Base content (%) 40.4% 59.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 116 181 83 33 88 93
Base content per 1 kb (bases) 391 609 279 111 296 313
Base content (%) 39.1% 60.9%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 755 1066 564 191 496 570
Base content per 1 kb (bases) 415 585 310 105 272 313
Base content (%) 41.5% 58.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 206 322 171 35 100 222
Base content per 1 kb (bases) 390 610 324 66 189 420
Base content (%) 39.0% 61.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 9 (3.98%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 8 10 8 4 19 3 8 7 1 1 4 6 1 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 6 8 4 0 5 4 2 0 5 2 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 1 3 3 3 0 1 4 1 1 0 1 5 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 3 1 0 0 3 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 67 78 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 62 37 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 57 87 71
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITILSTLITLFIIMQLKVSSHYYYSTPEPKTTKTTKSLIPWETKWTKIYSPLSLPLR*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 12 (17.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 9 (13.43%)
Isoleucine (Ile, I)
n = 7 (10.45%)
Methionine (Met, M)
n = 2 (2.99%)
Proline (Pro, P)
n = 6 (8.96%)
Phenylalanine (Phe, F)
n = 2 (2.99%)
Tyrosine (Tyr, Y)
n = 4 (5.97%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 2 (2.99%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 6 (8.96%)
Arginine (Arg, R)
n = 1 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 1 1 1 2 2 3 2 0 1 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 1 2 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 2 2 0 4 1 0 1 4 0 0 0 0 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 5 1 0 0 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 16 28 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 17 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 12 30 19
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.78%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 30 (5.84%)
Proline (Pro, P)
n = 29 (5.64%)
Phenylalanine (Phe, F)
n = 41 (7.98%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 14 23 12 6 26 4 12 5 1 6 12 17 5 16 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 16 11 14 0 13 14 19 1 16 8 5 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 0 14 4 10 0 0 3 8 11 0 0 7 10 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 2 7 8 8 1 3 0 5 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 109 134 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 95 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 146 188 160
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 7 (3.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 8 11 4 6 15 1 5 6 0 2 6 3 1 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 2 3 2 1 0 3 3 2 5 3 3 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 10 1 5 8 3 0 2 2 4 7 1 0 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 2 7 5 3 2 2 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 58 70 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 58 59 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 70 81 60
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 23 (8.85%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 36 (13.85%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 4 8 2 7 15 3 8 7 0 1 8 9 0 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 8 4 0 2 6 8 5 2 4 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 1 3 7 9 0 1 3 6 7 0 1 2 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 0 1 3 2 1 1 2 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 67 54 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 97 105 47
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 28 (7.39%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 30 (7.92%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 17 (4.49%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 7 (1.85%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 15 12 7 14 30 2 7 7 0 5 9 14 2 8 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 6 8 10 0 4 5 13 2 5 8 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 8 5 9 0 2 4 6 11 1 0 4 11 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 3 8 6 1 2 2 5 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
94 104 95 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 94 74 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 133 153 84
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 28 (8.81%)
Serine (Ser, S)
n = 20 (6.29%)
Threonine (Thr, T)
n = 27 (8.49%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 16 (5.03%)
Leucine (Leu, L)
n = 55 (17.3%)
Isoleucine (Ile, I)
n = 27 (8.49%)
Methionine (Met, M)
n = 18 (5.66%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 19 (5.97%)
Tyrosine (Tyr, Y)
n = 13 (4.09%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 16 6 7 33 0 9 5 1 4 2 10 0 6 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 3 14 11 0 2 5 6 0 1 10 11 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 14 0 1 9 6 1 0 3 6 7 1 0 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 0 3 6 1 0 3 5 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 85 94 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 94 56 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 116 151 45
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 16 (4.61%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 53 (15.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 59 (17.0%)
Isoleucine (Ile, I)
n = 38 (10.95%)
Methionine (Met, M)
n = 30 (8.65%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 26 30 10 9 32 4 4 6 2 1 2 8 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 1 8 7 0 1 9 4 0 4 9 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 23 0 4 9 8 0 1 1 1 9 0 0 4 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 0 11 0 1 2 0 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 94 152 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 111 59 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 133 156 53
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 16 (4.61%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 53 (15.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 59 (17.0%)
Isoleucine (Ile, I)
n = 38 (10.95%)
Methionine (Met, M)
n = 30 (8.65%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 26 30 10 9 32 4 4 6 2 1 2 8 0 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 1 8 7 0 1 9 4 0 4 9 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 23 0 4 9 8 0 1 1 1 9 0 0 4 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 0 11 0 1 2 0 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 94 152 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 111 59 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 133 156 53
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 42 (9.17%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 19 (4.15%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 16 27 16 16 44 5 16 11 2 5 2 7 0 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 3 11 14 0 1 9 4 3 5 11 7 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 1 7 16 4 0 1 10 4 11 4 0 7 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 0 0 3 11 0 3 2 5 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 138 156 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 121 80 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 152 182 104
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 11 1 4 11 2 5 2 0 0 0 6 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 1 4 1 0 3 1 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 1 7 0 0 0 1 3 1 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 24 31 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 15 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 35 47 12
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.95%)
Alanine (Ala, A)
n = 42 (6.93%)
Serine (Ser, S)
n = 48 (7.92%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 19 (3.14%)
Leucine (Leu, L)
n = 101 (16.67%)
Isoleucine (Ile, I)
n = 55 (9.08%)
Methionine (Met, M)
n = 36 (5.94%)
Proline (Pro, P)
n = 30 (4.95%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 15 (2.48%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 33 (5.45%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 34 33 13 24 47 6 11 16 1 2 6 10 1 15 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 11 13 17 1 2 15 13 0 4 16 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 19 2 11 14 15 0 1 7 8 7 0 0 11 22 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 2 2 7 22 0 1 3 4 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 157 212 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 170 119 255
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 237 239 114
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 6 (3.43%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 29 (16.57%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 12 (6.86%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 2 (1.14%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 5 (2.86%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 2 3 1 0 1 2 4 0 1 18 0 3 8 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 5 1 0 1 10 0 5 10 2 0 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 5 2 0 3 1 5 1 7 0 2 13 5 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 6 2 0 1 4 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 9 44 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 22 30 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
61 4 26 85
Total protein-coding genes (size: 11412 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 243 (6.39%)
Serine (Ser, S)
n = 284 (7.47%)
Threonine (Thr, T)
n = 342 (9.0%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 211 (5.55%)
Leucine (Leu, L)
n = 621 (16.33%)
Isoleucine (Ile, I)
n = 310 (8.15%)
Methionine (Met, M)
n = 229 (6.02%)
Proline (Pro, P)
n = 202 (5.31%)
Phenylalanine (Phe, F)
n = 228 (6.0%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 145 (3.81%)
Glutamine (Gln, Q)
n = 87 (2.29%)
Histidine (His, H)
n = 96 (2.52%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
154 156 189 84 105 288 37 92 78 9 47 51 95 18 92 136
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 4 20 58 89 92 4 40 74 79 24 54 75 70 3 73
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
115 140 14 62 84 77 3 16 42 60 73 10 15 54 91 39
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
57 77 15 24 41 80 12 15 17 33 2 1 0 10 0 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
828 966 1177 832
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
471 1013 720 1599
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
206 1226 1495 876

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.