Viewing data for Scolopax rusticola


Scientific name Scolopax rusticola
Common name Eurasian woodcock
Maximum lifespan 15.50 years (Scolopax rusticola@AnAge)

Total mtDNA (size: 16984 bases) GC AT G C A T
Base content (bases) 7335 9649 5070 2265 4249 5400
Base content per 1 kb (bases) 432 568 299 133 250 318
Base content (%) 43.2% 56.8%
Total protein-coding genes (size: 11370 bases) GC AT G C A T
Base content (bases) 4984 6386 3626 1358 2867 3519
Base content per 1 kb (bases) 438 562 319 119 252 309
Base content (%) 43.8% 56.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 642 909 382 260 399 510
Base content per 1 kb (bases) 414 586 246 168 257 329
Base content (%) 41.4% 58.6%
Total rRNA-coding genes (size: 2577 bases) GC AT G C A T
Base content (bases) 1115 1462 632 483 571 891
Base content per 1 kb (bases) 433 567 245 187 222 346
Base content (%) 43.3% 56.7%
12S rRNA gene (size: 979 bases) GC AT G C A T
Base content (bases) 442 537 248 194 214 323
Base content per 1 kb (bases) 451 549 253 198 219 330
Base content (%) 45.1% 54.9%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 673 925 384 289 357 568
Base content per 1 kb (bases) 421 579 240 181 223 355
Base content (%) 42.1% 57.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 307 377 240 67 178 199
Base content per 1 kb (bases) 449 551 351 98 260 291
Base content (%) 44.9% 55.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 61 9 40 58
Base content per 1 kb (bases) 417 583 363 54 238 345
Base content (%) 41.7% 58.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 701 850 452 249 418 432
Base content per 1 kb (bases) 452 548 291 161 270 279
Base content (%) 45.2% 54.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 294 390 194 100 177 213
Base content per 1 kb (bases) 430 570 284 146 259 311
Base content (%) 43.0% 57.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 347 437 224 123 211 226
Base content per 1 kb (bases) 443 557 286 157 269 288
Base content (%) 44.3% 55.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 516 627 380 136 287 340
Base content per 1 kb (bases) 451 549 332 119 251 297
Base content (%) 45.1% 54.9%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 444 534 321 123 272 262
Base content per 1 kb (bases) 454 546 328 126 278 268
Base content (%) 45.4% 54.6%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 426 613 332 94 266 347
Base content per 1 kb (bases) 410 590 320 90 256 334
Base content (%) 41.0% 59.0%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 151 200 110 41 95 105
Base content per 1 kb (bases) 430 570 313 117 271 299
Base content (%) 43.0% 57.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 596 782 460 136 345 437
Base content per 1 kb (bases) 433 567 334 99 250 317
Base content (%) 43.3% 56.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 128 169 89 39 80 89
Base content per 1 kb (bases) 431 569 300 131 269 300
Base content (%) 43.1% 56.9%
ND5 (size: 1809 bases) GC AT G C A T
Base content (bases) 785 1024 586 199 421 603
Base content per 1 kb (bases) 434 566 324 110 233 333
Base content (%) 43.4% 56.6%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 224 298 180 44 81 217
Base content per 1 kb (bases) 429 571 345 84 155 416
Base content (%) 42.9% 57.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 58 (25.55%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 5 (2.2%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 13 9 6 13 28 2 9 7 0 1 4 1 0 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 10 2 1 2 3 3 0 1 8 7 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 2 3 4 0 0 4 0 3 1 0 2 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 1 3 0 2 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 83 70 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 68 34 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 89 95 38
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMVLSWLTFLLLIQPKLLSLTTTNTPSNKISPTTKTTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 1 0 3 3 1 2 2 0 0 0 1 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 2 3 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 2 0 0 1 3 0 0 0 0 0 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 17 22 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 23 10 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 21 26 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 42 (8.14%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 41 (7.95%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 27 20 3 15 30 4 9 8 1 6 12 15 1 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 11 20 14 0 5 15 22 4 4 5 20 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 15 1 5 10 9 0 1 2 6 12 1 1 5 10 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 0 5 10 8 1 4 0 3 1 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 118 136 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 141 96 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 193 200 102
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 14 (6.17%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 9 3 7 10 2 9 7 0 1 5 7 3 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 4 5 5 0 3 3 2 0 3 3 7 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 1 4 3 10 0 0 4 4 4 1 0 2 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 14 1 5 7 4 0 1 1 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 56 55 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 61 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 80 97 41
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 9 6 3 2 15 2 8 7 1 2 4 8 0 8 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 8 10 0 0 9 10 1 1 4 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 1 2 4 9 0 1 3 4 6 1 1 0 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 2 1 3 4 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 63 57 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 92 114 43
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 26 (6.84%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 29 (7.63%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 66 (17.37%)
Isoleucine (Ile, I)
n = 28 (7.37%)
Methionine (Met, M)
n = 11 (2.89%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 30 (7.89%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 23 9 4 16 36 2 8 7 1 3 5 10 0 5 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 3 13 10 0 4 6 13 1 4 9 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 2 9 10 0 0 1 1 13 0 0 3 18 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 2 4 10 0 1 3 4 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 111 100 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 101 79 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 168 161 45
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 29 (8.92%)
Serine (Ser, S)
n = 29 (8.92%)
Threonine (Thr, T)
n = 23 (7.08%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 13 (4.0%)
Leucine (Leu, L)
n = 66 (20.31%)
Isoleucine (Ile, I)
n = 25 (7.69%)
Methionine (Met, M)
n = 10 (3.08%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 10 (3.08%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 8 11 13 29 2 11 3 2 0 2 11 0 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 4 15 10 0 4 6 4 0 4 9 9 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 6 2 5 11 8 0 0 5 2 13 2 0 4 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 0 2 2 6 1 4 1 2 1 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 95 83 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 100 56 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 126 123 62
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 26 (7.54%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 48 (13.91%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 32 (9.28%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.35%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 22 15 10 13 28 2 10 8 1 2 1 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 8 13 1 1 6 5 1 2 5 12 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 19 2 4 7 16 0 1 2 1 8 0 2 4 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 0 1 12 1 0 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 94 127 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 120 62 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 118 158 58
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 26 (7.54%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 48 (13.91%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 32 (9.28%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 19 (5.51%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.35%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 22 15 10 13 28 2 10 8 1 2 1 4 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 8 13 1 1 6 5 1 2 5 12 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 19 2 4 7 16 0 1 2 1 8 0 2 4 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 0 1 12 1 0 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 94 127 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 120 62 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 118 158 58
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 50 (10.92%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 7 (1.53%)
Leucine (Leu, L)
n = 102 (22.27%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 27 (5.9%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 9 (1.97%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 26 26 10 22 49 2 19 12 0 0 5 2 0 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 6 12 12 0 3 5 11 0 2 12 13 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 14 2 4 6 13 3 1 8 5 7 1 0 3 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 1 0 2 7 2 1 2 7 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 149 154 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 133 78 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 178 205 63
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 4 3 1 10 0 6 2 0 0 0 3 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 2 4 0 0 3 1 0 0 1 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 1 0 5 4 0 0 4 0 2 0 1 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 0 0 0 0 1 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 26 26 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 28 18 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 35 45 13
ND5 (size: 1809 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.48%)
Alanine (Ala, A)
n = 46 (7.64%)
Serine (Ser, S)
n = 41 (6.81%)
Threonine (Thr, T)
n = 73 (12.13%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 11 (1.83%)
Leucine (Leu, L)
n = 101 (16.78%)
Isoleucine (Ile, I)
n = 56 (9.3%)
Methionine (Met, M)
n = 36 (5.98%)
Proline (Pro, P)
n = 28 (4.65%)
Phenylalanine (Phe, F)
n = 33 (5.48%)
Tyrosine (Tyr, Y)
n = 14 (2.33%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 13 (2.16%)
Asparagine (Asn, N)
n = 31 (5.15%)
Glutamine (Gln, Q)
n = 19 (3.16%)
Histidine (His, H)
n = 12 (1.99%)
Lysine (Lys, K)
n = 22 (3.65%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 44 29 8 20 51 5 17 17 2 2 5 4 0 6 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 4 7 28 11 0 1 10 20 2 4 9 14 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 30 2 1 15 18 0 1 6 3 11 0 0 6 25 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 3 3 4 22 0 2 4 3 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 152 226 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 181 118 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 253 259 69
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 13 (7.51%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 34 (19.65%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 3 (1.73%)
Phenylalanine (Phe, F)
n = 12 (6.94%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 3 2 0 1 2 13 0 0 15 1 8 10 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 1 6 1 5 1 5 0 7 15 3 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 3 0 2 4 3 0 7 0 3 10 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 4 0 1 0 2 0 0 3 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 13 19 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 28 17 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 3 45 71
Total protein-coding genes (size: 11388 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.82%)
Alanine (Ala, A)
n = 285 (7.51%)
Serine (Ser, S)
n = 274 (7.22%)
Threonine (Thr, T)
n = 357 (9.41%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 165 (4.35%)
Leucine (Leu, L)
n = 665 (17.53%)
Isoleucine (Ile, I)
n = 296 (7.8%)
Methionine (Met, M)
n = 175 (4.61%)
Proline (Pro, P)
n = 216 (5.69%)
Phenylalanine (Phe, F)
n = 226 (5.96%)
Tyrosine (Tyr, Y)
n = 114 (3.0%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 61 (1.61%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 141 (3.72%)
Glutamine (Gln, Q)
n = 91 (2.4%)
Histidine (His, H)
n = 107 (2.82%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
94 202 142 65 132 301 26 126 83 8 32 44 75 14 71 155
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 10 20 56 126 100 3 28 67 101 25 31 69 110 6 63
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
146 136 12 34 76 109 7 8 40 34 80 12 15 31 110 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
79 87 9 24 37 81 5 17 16 31 8 1 2 5 2 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
828 1010 1106 851
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
481 1084 703 1527
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
187 1399 1583 626

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.