Viewing data for Acipenser gueldenstaedtii


Scientific name Acipenser gueldenstaedtii
Common name Russian sturgeon
Maximum lifespan 46.00 years (Acipenser gueldenstaedtii@AnAge)

Total mtDNA (size: 16594 bases) GC AT G C A T
Base content (bases) 7561 9032 4857 2704 4014 5018
Base content per 1 kb (bases) 456 544 293 163 242 302
Base content (%) 45.6% 54.4%
Total protein-coding genes (size: 11412 bases) GC AT G C A T
Base content (bases) 5282 6129 3577 1705 2819 3310
Base content per 1 kb (bases) 463 537 313 149 247 290
Base content (%) 46.3% 53.7%
D-loop (size: 877 bases) GC AT G C A T
Base content (bases) 327 550 198 129 269 281
Base content per 1 kb (bases) 373 627 226 147 307 320
Base content (%) 37.3% 62.7%
Total tRNA-coding genes (size: 1558 bases) GC AT G C A T
Base content (bases) 686 872 377 309 391 481
Base content per 1 kb (bases) 440 560 242 198 251 309
Base content (%) 44.0% 56.0%
Total rRNA-coding genes (size: 2663 bases) GC AT G C A T
Base content (bases) 1219 1444 677 542 521 923
Base content per 1 kb (bases) 458 542 254 204 196 347
Base content (%) 45.8% 54.2%
12S rRNA gene: No data available for this section.
16S rRNA gene: No data available for this section.

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 324 360 233 91 175 185
Base content per 1 kb (bases) 474 526 341 133 256 270
Base content (%) 47.4% 52.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 50 19 44 55
Base content per 1 kb (bases) 411 589 298 113 262 327
Base content (%) 41.1% 58.9%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 734 820 434 300 436 384
Base content per 1 kb (bases) 472 528 279 193 281 247
Base content (%) 47.2% 52.8%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 306 385 187 119 173 212
Base content per 1 kb (bases) 443 557 271 172 250 307
Base content (%) 44.3% 55.7%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 381 404 243 138 199 205
Base content per 1 kb (bases) 485 515 310 176 254 261
Base content (%) 48.5% 51.5%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 530 611 358 172 302 309
Base content per 1 kb (bases) 465 535 314 151 265 271
Base content (%) 46.5% 53.5%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 448 526 311 137 247 279
Base content per 1 kb (bases) 459 539 319 141 253 286
Base content (%) 45.9% 53.9%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 475 570 345 130 229 341
Base content per 1 kb (bases) 455 545 330 124 219 326
Base content (%) 45.5% 54.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 168 181 110 58 97 84
Base content per 1 kb (bases) 481 519 315 166 278 241
Base content (%) 48.1% 51.9%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 638 743 433 205 336 407
Base content per 1 kb (bases) 462 538 314 148 243 295
Base content (%) 46.2% 53.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 152 145 108 44 73 72
Base content per 1 kb (bases) 512 488 364 148 246 242
Base content (%) 51.2% 48.8%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 819 1023 585 234 453 570
Base content per 1 kb (bases) 445 555 318 127 246 309
Base content (%) 44.5% 55.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 244 278 184 60 61 217
Base content per 1 kb (bases) 467 533 352 115 117 416
Base content (%) 46.7% 53.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 56 (24.67%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 8 5 4 17 23 5 7 9 0 4 3 7 1 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 10 6 0 2 5 3 1 2 10 4 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 2 0 1 1 0 1 4 0 3 0 0 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 1 0 0 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 85 65 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 59 33 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 89 87 38
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFMILVFSWLIFLIVLPPKVLGHTFTNEPTHKNAEKIKPEPWTRPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.27%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 1 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 2 0 3 0 1 1 0 2 0 0 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 1 5 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 1 0 1 1 0 0 1 0 0 0 0 1 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 0 0 0 3 1 0 0 1 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
8 18 18 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 16 14 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 16 23 13
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 48 (9.28%)
Serine (Ser, S)
n = 30 (5.8%)
Threonine (Thr, T)
n = 36 (6.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.51%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 37 (7.16%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 13 9 8 24 10 9 7 1 7 8 20 9 20 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 8 27 11 2 7 17 14 9 7 10 9 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 3 5 9 9 2 0 5 7 12 0 2 6 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 4 5 10 7 1 2 2 3 1 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
164 114 125 115
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 183 165 112
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 27 (11.79%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 15 (6.55%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 7 4 5 10 4 4 8 0 4 2 9 5 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 2 6 6 2 0 3 5 1 2 5 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 1 2 7 5 0 1 2 6 4 0 0 2 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 2 0 12 4 0 0 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 62 52 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 65 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 70 95 44
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 25 (9.62%)
Serine (Ser, S)
n = 12 (4.62%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 7 (2.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 7 6 6 11 5 3 9 0 2 9 7 0 12 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 1 12 11 1 0 8 7 5 2 6 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 3 3 2 1 1 2 4 8 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 2 3 2 2 0 0 3 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 70 52 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 68 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 105 98 42
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 25 (6.6%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 9 10 15 22 5 4 7 2 5 6 11 3 12 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 16 8 0 3 8 14 3 1 10 9 3 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 1 4 9 9 0 0 1 4 9 0 2 7 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 0 1 10 7 2 0 0 7 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 104 94 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 98 79 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 156 136 64
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 33 (10.19%)
Serine (Ser, S)
n = 19 (5.86%)
Threonine (Thr, T)
n = 20 (6.17%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 16 (4.94%)
Leucine (Leu, L)
n = 61 (18.83%)
Isoleucine (Ile, I)
n = 24 (7.41%)
Methionine (Met, M)
n = 14 (4.32%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 14 (4.32%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 17 10 5 11 32 2 9 6 0 2 4 9 1 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 4 15 13 1 2 9 5 2 3 8 12 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 7 0 3 8 6 0 1 1 2 12 1 2 3 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 9 2 1 3 7 0 0 1 6 1 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 93 80 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 94 61 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 124 138 44
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 38 (10.95%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 15 20 6 12 33 7 4 12 2 1 3 3 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 2 22 13 1 2 7 7 0 1 10 6 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 19 1 0 7 8 1 4 3 4 5 2 0 3 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 0 2 10 0 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 99 129 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 120 59 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 126 153 48
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 38 (10.95%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 27 (7.78%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 15 20 6 12 33 7 4 12 2 1 3 3 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 2 22 13 1 2 7 7 0 1 10 6 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 19 1 0 7 8 1 4 3 4 5 2 0 3 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 1 0 2 10 0 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 99 129 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 120 59 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 126 153 48
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 41 (8.93%)
Serine (Ser, S)
n = 27 (5.88%)
Threonine (Thr, T)
n = 41 (8.93%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 15 (3.27%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 44 (9.59%)
Methionine (Met, M)
n = 27 (5.88%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 14 (3.05%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 9 (1.96%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 18 18 10 17 41 10 6 12 0 2 4 6 3 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 3 3 1 23 14 3 1 11 11 3 3 9 14 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 16 1 0 14 7 0 0 6 6 8 3 2 1 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 2 0 3 9 1 0 2 9 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 138 142 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 131 75 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 164 190 67
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 1 3 3 8 9 1 2 3 0 0 0 2 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 7 3 0 0 2 4 0 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 2 1 1 5 0 1 0 2 0 1 0 1 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 0 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 33 21 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 45 35 12
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 50 (8.16%)
Serine (Ser, S)
n = 44 (7.18%)
Threonine (Thr, T)
n = 64 (10.44%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 21 (3.43%)
Leucine (Leu, L)
n = 93 (15.17%)
Isoleucine (Ile, I)
n = 56 (9.14%)
Methionine (Met, M)
n = 29 (4.73%)
Proline (Pro, P)
n = 31 (5.06%)
Phenylalanine (Phe, F)
n = 41 (6.69%)
Tyrosine (Tyr, Y)
n = 11 (1.79%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 11 (1.79%)
Asparagine (Asn, N)
n = 30 (4.89%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 22 (3.59%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 28 21 9 22 40 9 11 21 1 4 5 11 1 16 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 4 4 32 13 1 2 11 15 3 3 14 12 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 24 2 4 13 12 1 1 13 4 7 2 2 4 26 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 0 2 10 21 1 0 2 5 2 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
125 158 215 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 175 125 240
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 252 230 97
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 29 (16.76%)
Leucine (Leu, L)
n = 32 (18.5%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 6 1 0 1 9 0 0 11 0 4 14 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 8 1 3 4 7 0 2 15 2 2 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 5 1 1 3 1 1 8 2 5 15 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 5 0 0 1 1 0 0 3 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 17 17 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 35 23 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 8 21 75
Total protein-coding genes (size: 11434 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 243 (6.38%)
Alanine (Ala, A)
n = 339 (8.9%)
Serine (Ser, S)
n = 232 (6.09%)
Threonine (Thr, T)
n = 312 (8.19%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 221 (5.8%)
Leucine (Leu, L)
n = 625 (16.41%)
Isoleucine (Ile, I)
n = 283 (7.43%)
Methionine (Met, M)
n = 175 (4.6%)
Proline (Pro, P)
n = 219 (5.75%)
Phenylalanine (Phe, F)
n = 221 (5.8%)
Tyrosine (Tyr, Y)
n = 118 (3.1%)
Tryptophan (Trp, W)
n = 118 (3.1%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 101 (2.65%)
Asparagine (Asn, N)
n = 130 (3.41%)
Glutamine (Gln, Q)
n = 104 (2.73%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 79 (2.07%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
148 135 117 76 128 259 60 76 98 6 45 47 89 40 105 116
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
58 10 18 38 176 110 15 26 84 89 44 30 93 83 13 34
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
141 123 14 29 81 62 9 10 41 46 72 16 26 32 98 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
80 83 18 18 57 72 7 4 15 49 8 0 0 5 2 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
979 1024 1030 775
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
516 1051 716 1525
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
336 1382 1417 673

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.