Viewing data for Capra caucasica


Scientific name Capra caucasica
Common name West Caucasian tur
Maximum lifespan 19.30 years (Capra caucasica@AnAge)

Total mtDNA (size: 16624 bases) GC AT G C A T
Base content (bases) 6529 10094 4349 2180 4525 5569
Base content per 1 kb (bases) 393 607 262 131 272 335
Base content (%) 39.3% 60.7%
Total protein-coding genes (size: 11335 bases) GC AT G C A T
Base content (bases) 4480 6855 3148 1332 3156 3699
Base content per 1 kb (bases) 395 605 278 118 278 326
Base content (%) 39.5% 60.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 546 964 315 231 430 534
Base content per 1 kb (bases) 361 638 208 153 285 353
Base content (%) 36.1% 63.8%
Total rRNA-coding genes (size: 2528 bases) GC AT G C A T
Base content (bases) 1001 1527 557 444 588 939
Base content per 1 kb (bases) 396 604 220 176 233 371
Base content (%) 39.6% 60.4%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 399 557 228 171 206 351
Base content per 1 kb (bases) 417 583 238 179 215 367
Base content (%) 41.7% 58.3%
16S rRNA gene (size: 1572 bases) GC AT G C A T
Base content (bases) 602 970 329 273 382 588
Base content per 1 kb (bases) 383 617 209 174 243 374
Base content (%) 38.3% 61.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 275 406 203 72 184 222
Base content per 1 kb (bases) 404 596 298 106 270 326
Base content (%) 40.4% 59.6%
ATP8 (size: 198 bases) GC AT G C A T
Base content (bases) 64 134 50 14 55 79
Base content per 1 kb (bases) 323 677 253 71 278 399
Base content (%) 32.3% 67.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 641 904 393 248 455 449
Base content per 1 kb (bases) 415 585 254 161 294 291
Base content (%) 41.5% 58.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 256 428 162 94 190 238
Base content per 1 kb (bases) 374 626 237 137 278 348
Base content (%) 37.4% 62.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 339 445 222 117 239 206
Base content per 1 kb (bases) 432 568 283 149 305 263
Base content (%) 43.2% 56.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 468 672 318 150 311 361
Base content per 1 kb (bases) 411 589 279 132 273 317
Base content (%) 41.1% 58.9%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 379 577 273 106 269 308
Base content per 1 kb (bases) 396 604 286 111 281 322
Base content (%) 39.6% 60.4%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 370 672 291 79 286 386
Base content per 1 kb (bases) 355 645 279 76 274 370
Base content (%) 35.5% 64.5%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 136 210 99 37 100 110
Base content per 1 kb (bases) 393 607 286 107 289 318
Base content (%) 39.3% 60.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 551 827 402 149 389 438
Base content per 1 kb (bases) 400 600 292 108 282 318
Base content (%) 40.0% 60.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 114 183 80 34 88 95
Base content per 1 kb (bases) 384 616 269 114 296 320
Base content (%) 38.4% 61.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 718 1103 517 201 498 605
Base content per 1 kb (bases) 394 606 284 110 273 332
Base content (%) 39.4% 60.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 188 340 151 37 115 225
Base content per 1 kb (bases) 356 644 286 70 218 426
Base content (%) 35.6% 64.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 10 7 5 10 19 2 8 9 0 1 1 7 0 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 1 8 7 0 1 3 6 1 2 6 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 1 3 1 7 0 2 3 0 2 1 0 1 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 4 0 0 2 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 68 82 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 65 38 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 70 102 46
ATP8 (size: 198 bases)
Amino acid sequence: MPQLDTSTWLTTILSMFLALFIIFQLKISKHDFYHNPELTTKVLKHNTPWETKWTKIYLPLLLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.54%)
Serine (Ser, S)
n = 3 (4.62%)
Threonine (Thr, T)
n = 9 (13.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.54%)
Leucine (Leu, L)
n = 13 (20.0%)
Isoleucine (Ile, I)
n = 5 (7.69%)
Methionine (Met, M)
n = 2 (3.08%)
Proline (Pro, P)
n = 5 (7.69%)
Phenylalanine (Phe, F)
n = 4 (6.15%)
Tyrosine (Tyr, Y)
n = 2 (3.08%)
Tryptophan (Trp, W)
n = 3 (4.62%)
Aspartic acid (Asp, D)
n = 2 (3.08%)
Glutamic acid (Glu, E)
n = 2 (3.08%)
Asparagine (Asn, N)
n = 2 (3.08%)
Glutamine (Gln, Q)
n = 2 (3.08%)
Histidine (His, H)
n = 3 (4.62%)
Lysine (Lys, K)
n = 6 (9.23%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 1 3 0 6 0 4 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 0 0 0 2 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 1 0 0 2 1 0 0 1 1 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 2 5 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 19 24 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 18 20 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 13 35 13
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 40 (7.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.81%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 17 29 11 5 27 4 13 4 2 6 6 19 4 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 8 15 17 0 7 9 26 5 9 10 9 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 0 7 6 13 1 1 2 7 12 1 0 10 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 2 5 11 9 0 0 2 4 2 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 106 142 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 152 212 126
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 13 3 2 15 4 9 6 0 6 1 5 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 1 1 6 0 3 1 4 0 1 5 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 1 4 3 8 1 1 4 7 3 0 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 12 3 4 6 6 0 2 0 4 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 56 69 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 51 109 53
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 4 8 6 10 1 8 6 1 3 5 6 1 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 6 7 3 0 5 7 7 1 0 6 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 3 5 6 1 2 2 7 4 0 1 5 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 0 4 2 0 2 1 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 66 59 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 90 91 69
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 22 (5.8%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 27 (7.12%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 22 (5.8%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 19 (5.01%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 20 17 4 16 25 3 7 4 2 0 11 11 0 7 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 2 5 15 0 2 5 14 3 4 5 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 16 1 4 3 11 0 0 3 11 4 1 0 5 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 1 4 7 9 0 0 1 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 97 117 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 90 77 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 131 167 69
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 33 (10.41%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 13 17 4 12 27 2 11 7 0 0 4 8 1 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 5 10 13 0 0 5 5 2 4 10 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 0 1 5 13 0 0 3 5 7 0 0 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 2 7 0 1 0 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 85 94 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 55 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 98 158 56
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 15 (4.34%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 42 (12.14%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 40 (11.56%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 17 38 1 16 29 0 10 8 1 0 4 4 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 4 5 0 1 4 9 0 0 8 12 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 1 5 6 13 2 0 2 3 5 0 0 6 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 1 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 85 153 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 57 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 103 176 61
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 15 (4.34%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 42 (12.14%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 40 (11.56%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 17 38 1 16 29 0 10 8 1 0 4 4 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 4 5 0 1 4 9 0 0 8 12 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 1 5 6 13 2 0 2 3 5 0 0 6 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 1 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 85 153 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 57 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 103 176 61
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 22 31 16 16 45 4 11 10 1 3 6 7 0 5 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 3 12 12 1 2 7 8 1 3 8 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 20 2 6 11 10 0 2 11 7 8 0 2 5 16 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 2 1 3 11 0 4 0 4 2 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 137 156 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 113 83 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 152 199 90
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 10 1 3 11 1 5 2 0 0 1 5 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 3 5 0 1 1 2 0 1 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 1 6 2 0 0 1 2 2 0 1 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 22 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 34 49 12
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 43 (7.1%)
Serine (Ser, S)
n = 45 (7.43%)
Threonine (Thr, T)
n = 56 (9.24%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 21 (3.47%)
Leucine (Leu, L)
n = 88 (14.52%)
Isoleucine (Ile, I)
n = 56 (9.24%)
Methionine (Met, M)
n = 40 (6.6%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 18 (2.97%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 31 35 10 17 41 3 16 15 4 6 9 6 0 15 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 3 7 14 20 2 0 10 17 1 1 12 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 27 2 7 13 14 2 4 5 12 6 1 1 10 27 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 1 2 8 21 2 0 4 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
114 137 221 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 160 134 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 220 250 112
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 7 (4.0%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 17 (9.71%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 13 (7.43%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 6 1 0 1 0 11 1 0 13 0 4 8 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 4 1 0 2 11 1 2 12 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 4 1 1 1 5 0 8 2 1 4 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 0 3 2 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 7 47 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 24 32 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 6 36 90
Total protein-coding genes (size: 11400 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 241 (6.35%)
Serine (Ser, S)
n = 273 (7.19%)
Threonine (Thr, T)
n = 323 (8.51%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 187 (4.92%)
Leucine (Leu, L)
n = 598 (15.75%)
Isoleucine (Ile, I)
n = 335 (8.82%)
Methionine (Met, M)
n = 254 (6.69%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 241 (6.35%)
Tyrosine (Tyr, Y)
n = 129 (3.4%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 161 (4.24%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 100 (2.63%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
185 150 214 73 109 267 25 115 77 11 39 48 86 14 104 137
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 7 16 46 85 105 5 33 53 103 26 30 74 87 2 60
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
87 166 10 45 61 102 10 17 38 70 59 5 9 55 106 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
73 79 16 22 46 93 5 10 11 39 4 1 0 5 2 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
806 919 1227 846
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
462 975 746 1615
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
184 1153 1638 823

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.