Viewing data for Vireo olivaceus


Scientific name Vireo olivaceus
Common name Red-eyed vireo
Maximum lifespan 10.20 years (Vireo olivaceus@AnAge)

Total mtDNA (size: 17295 bases) GC AT G C A T
Base content (bases) 7786 9506 5264 2522 3946 5560
Base content per 1 kb (bases) 450 550 304 146 228 321
Base content (%) 45.0% 55.0%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5253 6125 3746 1507 2554 3571
Base content per 1 kb (bases) 462 538 329 132 224 314
Base content (%) 46.2% 53.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 651 898 380 271 389 509
Base content per 1 kb (bases) 420 579 245 175 251 328
Base content (%) 42.0% 57.9%
Total rRNA-coding genes (size: 2571 bases) GC AT G C A T
Base content (bases) 1159 1412 627 532 555 857
Base content per 1 kb (bases) 451 549 244 207 216 333
Base content (%) 45.1% 54.9%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 459 513 250 209 210 303
Base content per 1 kb (bases) 472 528 257 215 216 312
Base content (%) 47.2% 52.8%
16S rRNA gene (size: 1599 bases) GC AT G C A T
Base content (bases) 700 899 377 323 345 554
Base content per 1 kb (bases) 438 562 236 202 216 346
Base content (%) 43.8% 56.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 310 374 232 78 157 217
Base content per 1 kb (bases) 453 547 339 114 230 317
Base content (%) 45.3% 54.7%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 75 93 62 13 32 61
Base content per 1 kb (bases) 446 554 369 77 190 363
Base content (%) 44.6% 55.4%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 714 837 455 259 367 470
Base content per 1 kb (bases) 460 540 293 167 237 303
Base content (%) 46.0% 54.0%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 318 367 216 102 153 214
Base content per 1 kb (bases) 464 536 315 149 223 312
Base content (%) 46.4% 53.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 383 401 255 128 177 224
Base content per 1 kb (bases) 489 511 325 163 226 286
Base content (%) 48.9% 51.1%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 525 618 378 147 269 349
Base content per 1 kb (bases) 459 541 331 129 235 305
Base content (%) 45.9% 54.1%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 451 527 313 138 251 276
Base content per 1 kb (bases) 461 539 320 141 257 282
Base content (%) 46.1% 53.9%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 477 563 363 114 246 317
Base content per 1 kb (bases) 459 541 349 110 237 305
Base content (%) 45.9% 54.1%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 156 195 113 43 83 112
Base content per 1 kb (bases) 444 556 322 123 236 319
Base content (%) 44.4% 55.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 629 749 470 159 305 444
Base content per 1 kb (bases) 456 544 341 115 221 322
Base content (%) 45.6% 54.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 144 153 104 40 71 82
Base content per 1 kb (bases) 485 515 350 135 239 276
Base content (%) 48.5% 51.5%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 833 985 608 225 381 604
Base content per 1 kb (bases) 458 542 334 124 210 332
Base content (%) 45.8% 54.2%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 243 275 180 63 66 209
Base content per 1 kb (bases) 468 530 347 121 127 403
Base content (%) 46.8% 53.0%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 6 3 10 42 5 1 8 0 2 0 10 0 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 9 6 1 0 3 3 2 0 2 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 0 0 6 4 1 1 3 0 3 0 0 1 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 3 4 0 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 92 62 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 75 120 20
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMIISWLTYSMIIQPKILAFTSTNPPTRKEPTTSTTTPWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 3 (5.45%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 1 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 5 0 0 0 3 0 0 2 0 0 0 0 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 0 1 0 0 0 0 0 0 1 3 5 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 1 0 2 1 0 0 1 0 1 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 2 0 0 1 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 15 26 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 23 11 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 24 24 4
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 39 (7.56%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 18 (3.49%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 26 14 3 7 47 3 1 10 0 5 5 25 4 7 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 9 19 19 0 3 6 34 4 2 4 24 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 1 3 10 11 0 1 3 0 18 0 0 1 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 0 2 13 9 0 1 1 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
158 126 129 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 191 246 57
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 17 (7.49%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 11 8 1 4 22 2 0 7 0 3 3 10 1 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 5 10 4 0 1 2 5 1 4 0 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 5 0 1 8 5 1 1 3 2 5 0 0 1 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 13 0 3 9 4 0 1 1 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 63 55 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 63 58 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 90 101 31
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 25 (9.62%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 10 7 3 4 22 4 0 8 0 5 1 8 3 1 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 14 6 2 0 8 10 1 2 4 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 1 2 3 4 0 0 4 1 10 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 0 1 4 4 0 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 75 59 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 69 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 111 109 27
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 27 (7.11%)
Serine (Ser, S)
n = 24 (6.32%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 23 (6.05%)
Leucine (Leu, L)
n = 65 (17.11%)
Isoleucine (Ile, I)
n = 31 (8.16%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 26 7 4 9 50 2 0 8 1 4 7 10 2 5 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 5 12 10 0 2 5 17 1 2 7 15 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 0 3 7 12 0 0 2 1 11 0 0 0 20 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 0 0 8 10 0 1 1 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 117 97 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 99 78 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 162 174 38
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 32 (9.85%)
Serine (Ser, S)
n = 23 (7.08%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 19 (5.85%)
Leucine (Leu, L)
n = 61 (18.77%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 12 (3.69%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 20 (6.15%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 7 (2.15%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 9 (2.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 8 3 8 41 8 1 7 0 1 6 12 0 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 3 14 14 1 0 7 6 1 5 7 11 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 5 0 5 7 6 0 0 5 2 12 1 0 4 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 1 3 7 0 3 1 4 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 103 78 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 92 59 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 118 139 50
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 30 (8.7%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 14 (4.06%)
Leucine (Leu, L)
n = 62 (17.97%)
Isoleucine (Ile, I)
n = 29 (8.41%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 16 (4.64%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 12 (3.48%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 24 14 6 10 40 6 0 8 2 1 5 7 1 2 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 6 13 10 1 1 6 6 0 4 9 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 12 0 6 8 9 1 0 5 2 4 0 0 5 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 0 0 1 11 2 1 0 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 108 118 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 115 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 140 140 47
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 30 (8.7%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 14 (4.06%)
Leucine (Leu, L)
n = 62 (17.97%)
Isoleucine (Ile, I)
n = 29 (8.41%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 16 (4.64%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 12 (3.48%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 24 14 6 10 40 6 0 8 2 1 5 7 1 2 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 6 13 10 1 1 6 6 0 4 9 8 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 12 0 6 8 9 1 0 5 2 4 0 0 5 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 0 0 1 11 2 1 0 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 108 118 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 115 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 140 140 47
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 41 (8.95%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 29 (6.33%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 15 (3.28%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 15 (3.28%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 30 23 7 15 60 12 1 14 0 0 0 8 1 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 2 25 14 0 1 4 12 1 3 10 14 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 18 0 4 6 16 2 0 9 1 13 0 0 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 3 0 2 10 0 1 1 9 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 162 146 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 137 80 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 171 218 44
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 7 (7.14%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 3 2 1 16 1 0 3 0 2 1 0 0 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 1 5 3 0 0 0 4 1 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 3 1 1 5 2 0 0 2 0 2 0 0 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 0 0 1 0 0 0 1 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 34 25 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 29 18 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 41 39 12
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 50 (8.26%)
Serine (Ser, S)
n = 47 (7.77%)
Threonine (Thr, T)
n = 66 (10.91%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 19 (3.14%)
Leucine (Leu, L)
n = 99 (16.36%)
Isoleucine (Ile, I)
n = 52 (8.6%)
Methionine (Met, M)
n = 32 (5.29%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 36 (5.95%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 26 (4.3%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 22 (3.64%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 40 24 4 13 73 9 0 18 1 1 8 9 1 5 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 6 1 33 16 0 2 8 20 3 3 9 19 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 31 1 1 13 19 1 1 12 1 11 0 0 2 24 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 1 2 8 20 2 0 2 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
123 171 212 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
75 181 112 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 256 280 43
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.7%)
Alanine (Ala, A)
n = 11 (6.4%)
Serine (Ser, S)
n = 18 (10.47%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 37 (21.51%)
Leucine (Leu, L)
n = 21 (12.21%)
Isoleucine (Ile, I)
n = 6 (3.49%)
Methionine (Met, M)
n = 8 (4.65%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 12 (6.98%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 2 4 0 3 10 4 0 0 19 1 5 12 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 6 0 2 3 8 1 3 15 2 0 1 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 7 0 3 3 4 0 6 1 1 0 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 3 0 0 0 1 0 0 5 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 27 23 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 30 16 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 5 27 82
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.87%)
Alanine (Ala, A)
n = 318 (8.38%)
Serine (Ser, S)
n = 273 (7.19%)
Threonine (Thr, T)
n = 316 (8.32%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 211 (5.56%)
Leucine (Leu, L)
n = 636 (16.75%)
Isoleucine (Ile, I)
n = 293 (7.72%)
Methionine (Met, M)
n = 172 (4.53%)
Proline (Pro, P)
n = 223 (5.87%)
Phenylalanine (Phe, F)
n = 224 (5.9%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 89 (2.34%)
Asparagine (Asn, N)
n = 133 (3.5%)
Glutamine (Gln, Q)
n = 101 (2.66%)
Histidine (His, H)
n = 105 (2.77%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 75 (1.98%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
82 211 120 41 85 439 63 8 96 5 43 37 106 25 50 174
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 2 26 43 161 106 8 18 50 125 30 29 57 133 4 42
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
138 131 5 33 78 94 9 8 50 17 92 2 0 22 111 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
93 80 9 13 54 82 4 9 11 47 8 1 1 6 1 104
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
908 1132 1060 696
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
492 1071 697 1536
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
226 1428 1678 464

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.