Viewing data for Triturus marmoratus


Scientific name Triturus marmoratus
Common name Marbled newt
Maximum lifespan 25.00 years (Triturus marmoratus@AnAge)

Total mtDNA (size: 16546 bases) GC AT G C A T
Base content (bases) 6757 9789 4259 2498 4506 5283
Base content per 1 kb (bases) 408 592 257 151 272 319
Base content (%) 40.8% 59.2%
Total protein-coding genes (size: 11346 bases) GC AT G C A T
Base content (bases) 4732 6614 3095 1637 3170 3444
Base content per 1 kb (bases) 417 583 273 144 279 304
Base content (%) 41.7% 58.3%
D-loop (size: 735 bases) GC AT G C A T
Base content (bases) 270 465 151 119 250 215
Base content per 1 kb (bases) 367 633 205 162 340 293
Base content (%) 36.7% 63.3%
Total tRNA-coding genes (size: 1528 bases) GC AT G C A T
Base content (bases) 592 936 342 250 423 513
Base content per 1 kb (bases) 387 613 224 164 277 336
Base content (%) 38.7% 61.3%
Total rRNA-coding genes (size: 2483 bases) GC AT G C A T
Base content (bases) 966 1517 526 440 568 949
Base content per 1 kb (bases) 389 611 212 177 229 382
Base content (%) 38.9% 61.1%
12S rRNA gene (size: 924 bases) GC AT G C A T
Base content (bases) 397 527 222 175 191 336
Base content per 1 kb (bases) 430 570 240 189 207 364
Base content (%) 43.0% 57.0%
16S rRNA gene (size: 1559 bases) GC AT G C A T
Base content (bases) 569 990 304 265 377 613
Base content per 1 kb (bases) 365 635 195 170 242 393
Base content (%) 36.5% 63.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 290 394 201 89 196 198
Base content per 1 kb (bases) 424 576 294 130 287 289
Base content (%) 42.4% 57.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 56 112 43 13 41 71
Base content per 1 kb (bases) 333 667 256 77 244 423
Base content (%) 33.3% 66.7%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 688 863 401 287 464 399
Base content per 1 kb (bases) 444 556 259 185 299 257
Base content (%) 44.4% 55.6%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 283 405 180 103 175 230
Base content per 1 kb (bases) 411 589 262 150 254 334
Base content (%) 41.1% 58.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 340 444 207 133 229 215
Base content per 1 kb (bases) 434 566 264 170 292 274
Base content (%) 43.4% 56.6%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 476 665 323 153 344 321
Base content per 1 kb (bases) 417 583 283 134 301 281
Base content (%) 41.7% 58.3%
ND1 (size: 967 bases) GC AT G C A T
Base content (bases) 388 579 246 142 290 289
Base content per 1 kb (bases) 401 599 254 147 300 299
Base content (%) 40.1% 59.9%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 424 615 299 125 272 343
Base content per 1 kb (bases) 408 592 288 120 262 330
Base content (%) 40.8% 59.2%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 150 198 102 48 103 95
Base content per 1 kb (bases) 431 569 293 138 296 273
Base content (%) 43.1% 56.9%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 590 788 399 191 385 403
Base content per 1 kb (bases) 428 572 290 139 279 292
Base content (%) 42.8% 57.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 81 45 76 95
Base content per 1 kb (bases) 424 576 273 152 256 320
Base content (%) 42.4% 57.6%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 713 1102 465 248 527 575
Base content per 1 kb (bases) 393 607 256 137 290 317
Base content (%) 39.3% 60.7%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 219 300 155 64 77 223
Base content per 1 kb (bases) 422 578 299 123 148 430
Base content (%) 42.2% 57.8%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 55 (24.23%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 12 7 10 21 4 13 5 3 2 4 3 1 10 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 8 2 1 1 4 2 4 3 3 8 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 2 4 3 1 0 0 5 1 2 3 0 2 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 2 1 1 0 2 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 74 71 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 62 35 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 65 92 47
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPGPWFSIFLTSWIIYLVILTAKINNFKYQNEPTPQNTKKEKTQPWDWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 4 (7.27%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 0 0 1 2 0 1 4 0 1 0 0 0 3 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 1 0 0 0 2 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 1 0 1 0 0 0 0 2 0 0 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 14 22 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 16 20 14
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 13 29 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 43 (8.33%)
Serine (Ser, S)
n = 35 (6.78%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 31 (6.01%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 40 (7.75%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 14 20 18 13 14 4 9 5 2 10 6 19 4 27 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 0 1 4 21 14 4 5 14 15 12 5 8 13 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 2 8 9 11 2 1 4 9 9 6 3 7 8 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 3 3 12 8 0 0 0 9 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 112 133 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 93 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 152 173 136
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 17 (7.46%)
Threonine (Thr, T)
n = 17 (7.46%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.7%)
Leucine (Leu, L)
n = 24 (10.53%)
Isoleucine (Ile, I)
n = 20 (8.77%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 7 (3.07%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 8 (3.51%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 13 3 4 10 0 7 6 3 2 4 5 2 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 1 5 10 0 0 3 5 0 2 0 12 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 2 2 6 5 0 0 4 6 2 0 0 3 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 5 4 7 3 1 1 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 54 69 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 66 101 45
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 2 10 4 7 7 4 9 8 0 4 3 9 1 13 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 9 10 0 1 6 9 5 4 3 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 7 1 5 0 0 3 5 5 2 0 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 3 1 5 3 0 0 0 5 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 62 55 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 53 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 78 107 60
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 30 (7.92%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 21 (5.54%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 36 (9.5%)
Methionine (Met, M)
n = 10 (2.64%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 21 9 16 5 23 1 11 8 1 9 3 9 0 11 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 5 10 8 0 0 11 8 6 4 7 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 0 9 6 11 0 0 4 3 11 0 2 4 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 2 5 3 9 2 1 1 6 1 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 96 102 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 94 77 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 133 142 89
ND1 (size: 967 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.98%)
Alanine (Ala, A)
n = 28 (8.72%)
Serine (Ser, S)
n = 23 (7.17%)
Threonine (Thr, T)
n = 20 (6.23%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 16 (4.98%)
Leucine (Leu, L)
n = 63 (19.63%)
Isoleucine (Ile, I)
n = 23 (7.17%)
Methionine (Met, M)
n = 22 (6.85%)
Proline (Pro, P)
n = 22 (6.85%)
Phenylalanine (Phe, F)
n = 19 (5.92%)
Tyrosine (Tyr, Y)
n = 10 (3.12%)
Tryptophan (Trp, W)
n = 7 (2.18%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 11 (3.43%)
Asparagine (Asn, N)
n = 12 (3.74%)
Glutamine (Gln, Q)
n = 6 (1.87%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 9 (2.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 17 9 7 22 6 15 4 2 4 2 7 3 15 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 8 18 0 0 7 7 2 6 2 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 1 4 4 11 2 0 2 7 3 2 4 6 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 4 1 3 7 0 0 1 8 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 84 86 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 91 53 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 71 150 69
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.64%)
Alanine (Ala, A)
n = 32 (9.28%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 31 (8.99%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 26 (7.54%)
Methionine (Met, M)
n = 33 (9.57%)
Proline (Pro, P)
n = 18 (5.22%)
Phenylalanine (Phe, F)
n = 9 (2.61%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.64%)
Glutamine (Gln, Q)
n = 7 (2.03%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 14 29 10 7 32 4 12 7 0 1 3 3 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 14 10 2 1 4 7 4 2 6 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 17 1 4 12 11 1 1 6 4 3 1 1 5 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 2 0 10 2 0 1 1 2 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 90 125 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 109 56 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 100 162 60
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.64%)
Alanine (Ala, A)
n = 32 (9.28%)
Serine (Ser, S)
n = 35 (10.14%)
Threonine (Thr, T)
n = 31 (8.99%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 26 (7.54%)
Methionine (Met, M)
n = 33 (9.57%)
Proline (Pro, P)
n = 18 (5.22%)
Phenylalanine (Phe, F)
n = 9 (2.61%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.64%)
Glutamine (Gln, Q)
n = 7 (2.03%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 14 29 10 7 32 4 12 7 0 1 3 3 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 14 10 2 1 4 7 4 2 6 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 17 1 4 12 11 1 1 6 4 3 1 1 5 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 2 0 10 2 0 1 1 2 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 90 125 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 109 56 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 100 162 60
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 34 (7.42%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 44 (9.61%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 20 (4.37%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 36 (7.86%)
Methionine (Met, M)
n = 29 (6.33%)
Proline (Pro, P)
n = 25 (5.46%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 15 (3.28%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 12 25 11 19 27 12 22 10 1 4 5 10 1 8 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 4 16 14 0 2 9 5 4 2 9 8 6 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 6 9 4 18 0 1 7 6 6 4 3 5 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 2 0 3 9 1 0 1 7 3 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 128 143 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 134 73 194
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 137 187 88
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 14 (14.29%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 8 2 3 7 1 6 2 0 0 0 2 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 1 4 3 0 1 3 2 1 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 1 0 2 3 1 0 1 0 1 1 0 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 1 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 23 32 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 31 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 27 47 14
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.8%)
Alanine (Ala, A)
n = 50 (8.28%)
Serine (Ser, S)
n = 53 (8.77%)
Threonine (Thr, T)
n = 48 (7.95%)
Cysteine (Cys, C)
n = 8 (1.32%)
Valine (Val, V)
n = 22 (3.64%)
Leucine (Leu, L)
n = 83 (13.74%)
Isoleucine (Ile, I)
n = 57 (9.44%)
Methionine (Met, M)
n = 42 (6.95%)
Proline (Pro, P)
n = 26 (4.3%)
Phenylalanine (Phe, F)
n = 43 (7.12%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 31 (5.13%)
Glutamine (Gln, Q)
n = 21 (3.48%)
Histidine (His, H)
n = 10 (1.66%)
Lysine (Lys, K)
n = 25 (4.14%)
Arginine (Arg, R)
n = 10 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 27 38 10 16 27 10 15 20 1 5 3 12 2 30 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 4 4 10 21 16 3 2 8 14 5 10 1 9 6 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 18 3 8 6 25 4 1 9 5 6 2 5 10 21 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 5 4 7 20 5 1 1 8 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
124 130 213 138
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 167 122 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 168 240 142
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.37%)
Alanine (Ala, A)
n = 14 (8.14%)
Serine (Ser, S)
n = 16 (9.3%)
Threonine (Thr, T)
n = 3 (1.74%)
Cysteine (Cys, C)
n = 5 (2.91%)
Valine (Val, V)
n = 25 (14.53%)
Leucine (Leu, L)
n = 30 (17.44%)
Isoleucine (Ile, I)
n = 8 (4.65%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 12 (6.98%)
Tyrosine (Tyr, Y)
n = 9 (5.23%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 1 3 6 1 2 2 8 0 0 9 1 8 7 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 4 1 7 3 2 2 8 0 4 11 2 1 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 9 0 2 0 4 1 8 1 2 11 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 1 0 0 1 0 0 2 1 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 19 23 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 32 19 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 13 35 82
Total protein-coding genes (size: 11379 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 228 (6.02%)
Alanine (Ala, A)
n = 292 (7.7%)
Serine (Ser, S)
n = 294 (7.76%)
Threonine (Thr, T)
n = 299 (7.89%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 198 (5.22%)
Leucine (Leu, L)
n = 616 (16.25%)
Isoleucine (Ile, I)
n = 288 (7.6%)
Methionine (Met, M)
n = 228 (6.02%)
Proline (Pro, P)
n = 201 (5.3%)
Phenylalanine (Phe, F)
n = 231 (6.09%)
Tyrosine (Tyr, Y)
n = 107 (2.82%)
Tryptophan (Trp, W)
n = 113 (2.98%)
Aspartic acid (Asp, D)
n = 70 (1.85%)
Glutamic acid (Glu, E)
n = 92 (2.43%)
Asparagine (Asn, N)
n = 140 (3.69%)
Glutamine (Gln, Q)
n = 95 (2.51%)
Histidine (His, H)
n = 97 (2.56%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 74 (1.95%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
160 128 185 102 101 202 49 132 81 14 52 35 88 23 152 79
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 11 20 47 121 109 15 20 72 80 56 42 43 97 19 53
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
89 139 18 66 54 110 10 8 46 55 52 24 30 43 97 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
69 64 28 24 46 78 12 5 6 54 9 1 0 5 1 89
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
880 921 1100 890
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
501 1032 697 1561
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
351 1058 1514 868

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.