Viewing data for Tupaia belangeri


Scientific name Tupaia belangeri
Common name Northern tree shrew
Maximum lifespan 11.10 years (Tupaia belangeri@AnAge)

Total mtDNA (size: 16754 bases) GC AT G C A T
Base content (bases) 6827 9927 4420 2407 4448 5479
Base content per 1 kb (bases) 407 593 264 144 265 327
Base content (%) 40.7% 59.3%
Total protein-coding genes (size: 11343 bases) GC AT G C A T
Base content (bases) 4677 6666 3184 1493 3084 3582
Base content per 1 kb (bases) 412 588 281 132 272 316
Base content (%) 41.2% 58.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1490 bases) GC AT G C A T
Base content (bases) 586 904 330 256 395 509
Base content per 1 kb (bases) 393 607 221 172 265 342
Base content (%) 39.3% 60.7%
Total rRNA-coding genes (size: 2520 bases) GC AT G C A T
Base content (bases) 1034 1486 562 472 576 910
Base content per 1 kb (bases) 410 590 223 187 229 361
Base content (%) 41.0% 59.0%
12S rRNA gene (size: 948 bases) GC AT G C A T
Base content (bases) 400 548 225 175 214 334
Base content per 1 kb (bases) 422 578 237 185 226 352
Base content (%) 42.2% 57.8%
16S rRNA gene (size: 1572 bases) GC AT G C A T
Base content (bases) 634 938 337 297 362 576
Base content per 1 kb (bases) 403 597 214 189 230 366
Base content (%) 40.3% 59.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 306 375 211 95 179 196
Base content per 1 kb (bases) 449 551 310 140 263 288
Base content (%) 44.9% 55.1%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 70 134 54 16 54 80
Base content per 1 kb (bases) 343 657 265 78 265 392
Base content (%) 34.3% 65.7%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 671 871 405 266 458 413
Base content per 1 kb (bases) 435 565 263 173 297 268
Base content (%) 43.5% 56.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 280 404 184 96 182 222
Base content per 1 kb (bases) 409 591 269 140 266 325
Base content (%) 40.9% 59.1%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 337 449 214 123 221 228
Base content per 1 kb (bases) 429 571 272 156 281 290
Base content (%) 42.9% 57.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 497 643 327 170 313 330
Base content per 1 kb (bases) 436 564 287 149 275 289
Base content (%) 43.6% 56.4%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 378 579 252 126 270 309
Base content per 1 kb (bases) 395 605 263 132 282 323
Base content (%) 39.5% 60.5%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 395 649 285 110 264 385
Base content per 1 kb (bases) 378 622 273 105 253 369
Base content (%) 37.8% 62.2%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 152 195 105 47 91 104
Base content per 1 kb (bases) 438 562 303 135 262 300
Base content (%) 43.8% 56.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 550 828 395 155 382 446
Base content per 1 kb (bases) 399 601 287 112 277 324
Base content (%) 39.9% 60.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 123 174 83 40 98 76
Base content per 1 kb (bases) 414 586 279 135 330 256
Base content (%) 41.4% 58.6%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 725 1087 511 214 494 593
Base content per 1 kb (bases) 400 600 282 118 273 327
Base content (%) 40.0% 60.0%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 211 311 171 40 93 218
Base content per 1 kb (bases) 404 596 328 77 178 418
Base content (%) 40.4% 59.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (7.08%)
Leucine (Leu, L)
n = 41 (18.14%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 13 8 5 6 20 3 6 7 0 3 6 6 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 2 10 5 1 1 4 4 2 4 4 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 1 4 2 3 1 2 3 0 2 1 1 2 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 1 0 1 3 2 0 1 3 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 67 76 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 64 34 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 80 86 39
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIVSMLATLFILFQLKLSSYCYYNLPQTKTMKTKKQDTPWNQKWTKTYLPLSLPRH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.49%)
Serine (Ser, S)
n = 5 (7.46%)
Threonine (Thr, T)
n = 10 (14.93%)
Cysteine (Cys, C)
n = 1 (1.49%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 3 (4.48%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 5 (7.46%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 4 (5.97%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 2 (2.99%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (2.99%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 1 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 1 0 2 2 4 5 0 0 1 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 0 0 0 0 0 0 0 2 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 1 0 3 1 0 0 1 1 3 0 1 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 1 1 6 1 0 0 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 17 26 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 20 22 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 17 32 13
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.16%)
Alanine (Ala, A)
n = 42 (8.19%)
Serine (Ser, S)
n = 31 (6.04%)
Threonine (Thr, T)
n = 37 (7.21%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.21%)
Leucine (Leu, L)
n = 60 (11.7%)
Isoleucine (Ile, I)
n = 38 (7.41%)
Methionine (Met, M)
n = 30 (5.85%)
Proline (Pro, P)
n = 29 (5.65%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.12%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.51%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 16 22 12 8 20 5 12 6 1 11 13 13 0 15 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 11 15 13 3 7 15 17 8 11 8 9 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 18 4 4 4 18 2 1 2 6 13 0 3 7 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 2 8 7 8 1 2 2 3 1 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 107 133 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 95 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 162 185 128
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 13 10 8 6 14 0 3 4 2 3 2 6 1 5 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 1 2 4 1 1 1 2 4 1 3 3 7 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 0 3 2 9 1 0 4 4 5 0 2 1 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 12 2 2 9 5 0 0 0 5 1 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 62 68 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 67 94 50
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 18 (6.9%)
Serine (Ser, S)
n = 18 (6.9%)
Threonine (Thr, T)
n = 24 (9.2%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 29 (11.11%)
Isoleucine (Ile, I)
n = 14 (5.36%)
Methionine (Met, M)
n = 11 (4.21%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 26 (9.96%)
Tyrosine (Tyr, Y)
n = 10 (3.83%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 8 (3.07%)
Asparagine (Asn, N)
n = 7 (2.68%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 15 (5.75%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 4 8 2 5 13 2 7 7 0 4 2 8 2 12 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 11 5 0 0 6 14 1 4 2 4 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 1 4 2 8 1 0 3 3 7 1 0 2 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 0 1 3 2 1 1 2 2 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 60 62 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 86 111 52
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 23 (6.07%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 25 (6.6%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 35 (9.23%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 13 (3.43%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 22 10 8 7 26 3 9 5 1 5 5 14 1 7 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 5 13 9 0 4 7 14 1 4 3 14 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 1 3 7 9 1 0 3 2 14 1 1 5 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 3 10 7 2 1 0 7 0 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
97 93 99 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 92 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 142 152 67
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 25 (7.86%)
Serine (Ser, S)
n = 24 (7.55%)
Threonine (Thr, T)
n = 21 (6.6%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 15 (4.72%)
Leucine (Leu, L)
n = 58 (18.24%)
Isoleucine (Ile, I)
n = 26 (8.18%)
Methionine (Met, M)
n = 23 (7.23%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 20 (6.29%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 8 (2.52%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 11 (3.46%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 12 19 2 3 32 7 12 5 1 2 4 8 1 10 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 4 10 11 0 4 2 5 2 2 5 15 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 15 0 3 4 11 1 0 5 2 9 0 2 5 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 1 3 5 2 1 1 6 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 83 93 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 87 54 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 82 162 53
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 22 (6.34%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 59 (17.0%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 31 (8.93%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 9 (2.59%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 16 (4.61%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 23 28 7 6 31 3 11 9 0 0 5 6 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 10 7 0 0 2 12 2 1 4 14 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 21 1 1 3 16 1 2 3 3 5 2 1 3 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 2 1 14 2 0 0 3 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 82 143 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 106 59 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 97 183 50
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 22 (6.34%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 59 (17.0%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 31 (8.93%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 9 (2.59%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 3 (0.86%)
Lysine (Lys, K)
n = 16 (4.61%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 23 28 7 6 31 3 11 9 0 0 5 6 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 5 10 7 0 0 2 12 2 1 4 14 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 21 1 1 3 16 1 2 3 3 5 2 1 3 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 2 1 14 2 0 0 3 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 82 143 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 106 59 148
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 97 183 50
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 43 (9.39%)
Threonine (Thr, T)
n = 34 (7.42%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 40 (8.73%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 9 (1.97%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 14 (3.06%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 25 33 10 13 44 7 16 9 0 3 4 7 1 5 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 5 16 7 0 4 7 4 3 3 2 18 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 12 0 6 6 17 1 4 9 4 10 0 1 3 17 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 3 1 3 12 2 3 2 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 126 164 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 115 80 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 154 202 78
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 3 (3.06%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 27 (27.55%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 5 4 5 11 3 4 1 1 1 3 3 1 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 6 1 0 1 1 2 0 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 4 0 4 0 0 0 2 1 0 0 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 30 22 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 22 17 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 31 37 23
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.64%)
Alanine (Ala, A)
n = 43 (7.13%)
Serine (Ser, S)
n = 49 (8.13%)
Threonine (Thr, T)
n = 59 (9.78%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 23 (3.81%)
Leucine (Leu, L)
n = 84 (13.93%)
Isoleucine (Ile, I)
n = 61 (10.12%)
Methionine (Met, M)
n = 40 (6.63%)
Proline (Pro, P)
n = 27 (4.48%)
Phenylalanine (Phe, F)
n = 38 (6.3%)
Tyrosine (Tyr, Y)
n = 20 (3.32%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 27 (4.48%)
Glutamine (Gln, Q)
n = 18 (2.99%)
Histidine (His, H)
n = 16 (2.65%)
Lysine (Lys, K)
n = 23 (3.81%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 35 34 13 12 37 7 14 16 2 6 2 10 5 14 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 3 4 24 11 4 3 6 14 5 5 5 16 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 24 2 6 9 27 0 1 6 6 14 2 1 10 17 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 2 3 8 23 0 1 2 5 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
115 139 217 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 171 126 246
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 201 250 115
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.03%)
Alanine (Ala, A)
n = 7 (4.05%)
Serine (Ser, S)
n = 14 (8.09%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 25 (14.45%)
Leucine (Leu, L)
n = 19 (10.98%)
Isoleucine (Ile, I)
n = 15 (8.67%)
Methionine (Met, M)
n = 10 (5.78%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 12 (6.94%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 8 (4.62%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 8 (4.62%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 0 2 0 0 1 0 9 0 0 10 1 4 10 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 0 4 0 0 3 10 4 2 10 4 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 4 2 1 0 7 0 6 1 3 9 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 7 4 0 1 1 1 0 0 2 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 8 41 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 23 24 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 9 28 82
Total protein-coding genes (size: 11394 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.85%)
Alanine (Ala, A)
n = 260 (6.85%)
Serine (Ser, S)
n = 281 (7.4%)
Threonine (Thr, T)
n = 305 (8.03%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 209 (5.51%)
Leucine (Leu, L)
n = 591 (15.57%)
Isoleucine (Ile, I)
n = 325 (8.56%)
Methionine (Met, M)
n = 243 (6.4%)
Proline (Pro, P)
n = 200 (5.27%)
Phenylalanine (Phe, F)
n = 230 (6.06%)
Tyrosine (Tyr, Y)
n = 128 (3.37%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 75 (1.98%)
Glutamic acid (Glu, E)
n = 91 (2.4%)
Asparagine (Asn, N)
n = 139 (3.66%)
Glutamine (Gln, Q)
n = 85 (2.24%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 103 (2.71%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
154 171 186 75 75 264 47 108 76 9 48 49 88 24 95 135
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
57 8 21 49 123 76 12 35 59 93 35 45 40 108 7 48
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
98 146 13 43 46 126 9 17 40 41 87 10 22 44 95 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
69 71 20 27 48 89 14 10 11 41 6 0 0 6 5 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
857 910 1172 858
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
482 989 728 1598
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
290 1167 1574 766

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.