Viewing data for Taurotragus derbianus


Scientific name Taurotragus derbianus
Common name Giant eland
Maximum lifespan 20.30 years (Taurotragus derbianus@AnAge)

Total mtDNA (size: 16399 bases) GC AT G C A T
Base content (bases) 6491 9908 4265 2226 4413 5495
Base content per 1 kb (bases) 396 604 260 136 269 335
Base content (%) 39.6% 60.4%
Total protein-coding genes (size: 11336 bases) GC AT G C A T
Base content (bases) 4563 6773 3150 1413 3100 3673
Base content per 1 kb (bases) 403 597 278 125 273 324
Base content (%) 40.3% 59.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1510 bases) GC AT G C A T
Base content (bases) 546 964 324 222 426 538
Base content per 1 kb (bases) 362 638 215 147 282 356
Base content (%) 36.2% 63.8%
Total rRNA-coding genes (size: 2526 bases) GC AT G C A T
Base content (bases) 986 1540 550 436 590 950
Base content per 1 kb (bases) 390 610 218 173 234 376
Base content (%) 39.0% 61.0%
12S rRNA gene (size: 959 bases) GC AT G C A T
Base content (bases) 383 576 215 168 223 353
Base content per 1 kb (bases) 399 601 224 175 233 368
Base content (%) 39.9% 60.1%
16S rRNA gene (size: 1567 bases) GC AT G C A T
Base content (bases) 603 964 335 268 367 597
Base content per 1 kb (bases) 385 615 214 171 234 381
Base content (%) 38.5% 61.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 282 399 202 80 183 216
Base content per 1 kb (bases) 414 586 297 117 269 317
Base content (%) 41.4% 58.6%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 66 135 50 16 53 82
Base content per 1 kb (bases) 328 672 249 80 264 408
Base content (%) 32.8% 67.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 641 904 381 260 463 441
Base content per 1 kb (bases) 415 585 247 168 300 285
Base content (%) 41.5% 58.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 270 414 166 104 184 230
Base content per 1 kb (bases) 395 605 243 152 269 336
Base content (%) 39.5% 60.5%
COX3 (size: 781 bases) GC AT G C A T
Base content (bases) 352 429 233 119 217 212
Base content per 1 kb (bases) 451 549 298 152 278 271
Base content (%) 45.1% 54.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 483 657 332 151 291 366
Base content per 1 kb (bases) 424 576 291 132 255 321
Base content (%) 42.4% 57.6%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 398 559 274 124 259 300
Base content per 1 kb (bases) 416 584 286 130 271 313
Base content (%) 41.6% 58.4%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 377 665 284 93 283 382
Base content per 1 kb (bases) 362 638 273 89 272 367
Base content (%) 36.2% 63.8%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 137 209 97 40 99 110
Base content per 1 kb (bases) 396 604 280 116 286 318
Base content (%) 39.6% 60.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 543 835 388 155 391 444
Base content per 1 kb (bases) 394 606 282 112 284 322
Base content (%) 39.4% 60.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 118 179 77 41 88 91
Base content per 1 kb (bases) 397 603 259 138 296 306
Base content (%) 39.7% 60.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 721 1100 524 197 496 604
Base content per 1 kb (bases) 396 604 288 108 272 332
Base content (%) 39.6% 60.4%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 196 332 157 39 113 219
Base content per 1 kb (bases) 371 629 297 74 214 415
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 8 4 9 15 4 9 9 0 2 3 6 1 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 5 7 6 0 2 2 6 1 1 3 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 0 1 2 6 0 0 5 1 1 0 2 5 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 4 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 63 80 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 64 37 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 75 99 41
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMIMSMFLTLFIIFQLKISKHNLYHNPEPTTTKVSKQNTPWEMKWTKTYLPLSLPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.58%)
Threonine (Thr, T)
n = 10 (15.15%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 9 (13.64%)
Isoleucine (Ile, I)
n = 4 (6.06%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 3 (4.55%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 4 (6.06%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 3 2 0 3 1 2 4 0 0 0 1 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 2 1 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 1 0 0 4 1 0 0 2 0 1 1 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 5 1 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 18 28 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 21 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 11 33 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 37 (7.2%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 16 24 8 8 16 6 17 6 0 9 5 20 4 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 0 9 15 15 1 8 9 28 2 8 9 10 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 17 2 4 9 15 0 1 2 10 9 3 3 6 13 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 0 5 11 7 2 1 1 6 0 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 97 140 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 151 205 125
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 5 (2.2%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 14 5 1 13 7 7 4 2 2 4 4 3 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 1 2 4 1 1 3 3 1 3 3 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 11 0 2 6 8 0 1 4 6 5 1 1 3 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 4 5 5 6 0 0 1 4 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 59 67 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 52 102 50
COX3 (size: 781 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.72%)
Alanine (Ala, A)
n = 16 (6.18%)
Serine (Ser, S)
n = 19 (7.34%)
Threonine (Thr, T)
n = 23 (8.88%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.79%)
Leucine (Leu, L)
n = 32 (12.36%)
Isoleucine (Ile, I)
n = 15 (5.79%)
Methionine (Met, M)
n = 10 (3.86%)
Proline (Pro, P)
n = 12 (4.63%)
Phenylalanine (Phe, F)
n = 24 (9.27%)
Tyrosine (Tyr, Y)
n = 12 (4.63%)
Tryptophan (Trp, W)
n = 12 (4.63%)
Aspartic acid (Asp, D)
n = 3 (1.16%)
Glutamic acid (Glu, E)
n = 8 (3.09%)
Asparagine (Asn, N)
n = 5 (1.93%)
Glutamine (Gln, Q)
n = 7 (2.7%)
Histidine (His, H)
n = 17 (6.56%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 7 8 6 4 12 4 6 7 0 1 5 6 3 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 3 9 4 0 2 8 10 0 1 5 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 1 3 5 5 1 2 3 6 6 0 0 0 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 1 0 3 2 0 0 4 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 68 60 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 65 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 100 98 50
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 27 (7.12%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 19 (5.01%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 26 17 4 12 31 3 8 6 0 3 4 10 1 5 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 2 6 16 0 0 6 15 3 4 5 13 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 15 1 1 6 12 1 1 4 6 10 1 0 2 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 2 9 8 1 0 0 7 1 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 98 114 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 93 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 141 176 49
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 20 (6.29%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 15 (4.72%)
Leucine (Leu, L)
n = 53 (16.67%)
Isoleucine (Ile, I)
n = 29 (9.12%)
Methionine (Met, M)
n = 20 (6.29%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 22 (6.92%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 18 17 3 5 27 8 10 6 1 1 3 8 3 7 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 9 15 0 0 6 6 1 6 10 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 1 1 6 12 0 0 2 6 6 0 0 3 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 0 3 7 0 0 2 4 2 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 83 91 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 57 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 101 152 46
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 14 39 3 11 28 3 9 9 0 7 1 5 1 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 9 8 0 1 4 9 0 1 7 11 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 17 0 1 6 16 0 0 2 4 4 0 0 2 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 1 10 2 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 82 147 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 55 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 100 180 58
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.05%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.47%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 14 39 3 11 28 3 9 9 0 7 1 5 1 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 9 8 0 1 4 9 0 1 7 11 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 17 0 1 6 16 0 0 2 4 4 0 0 2 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 1 10 2 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 82 147 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 102 55 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 100 180 58
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 18 29 15 13 40 7 14 9 2 2 3 10 1 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 4 9 14 0 2 7 8 1 2 11 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 1 6 10 10 0 2 8 9 8 4 3 4 19 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 0 1 2 11 1 0 2 7 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 129 160 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 114 85 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 145 199 87
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 10 0 3 12 4 3 2 0 0 2 5 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 0 4 4 1 1 0 2 1 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 1 5 2 1 1 0 1 3 0 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 25 27 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 28 47 15
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 39 (6.44%)
Serine (Ser, S)
n = 49 (8.09%)
Threonine (Thr, T)
n = 53 (8.75%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 64 (10.56%)
Methionine (Met, M)
n = 41 (6.77%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 48 (7.92%)
Tyrosine (Tyr, Y)
n = 18 (2.97%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 39 37 12 15 43 4 15 16 2 1 6 10 1 19 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 5 16 16 2 2 12 14 0 3 11 10 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 27 3 7 14 12 1 1 14 6 12 2 0 14 20 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 2 9 22 1 0 5 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 138 230 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 152 128 260
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 234 246 104
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 0 4 1 0 0 2 8 0 1 8 1 7 8 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 4 0 1 1 12 1 3 10 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 3 4 1 1 1 4 0 7 2 3 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 6 3 1 2 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 8 47 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 24 32 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 7 34 84
Total protein-coding genes (size: 11401 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.69%)
Alanine (Ala, A)
n = 246 (6.48%)
Serine (Ser, S)
n = 274 (7.21%)
Threonine (Thr, T)
n = 314 (8.27%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 193 (5.08%)
Leucine (Leu, L)
n = 590 (15.53%)
Isoleucine (Ile, I)
n = 330 (8.69%)
Methionine (Met, M)
n = 264 (6.95%)
Proline (Pro, P)
n = 194 (5.11%)
Phenylalanine (Phe, F)
n = 244 (6.42%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 157 (4.13%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 97 (2.55%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
167 163 216 64 86 255 55 112 81 8 37 37 92 27 102 142
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 8 14 45 89 106 6 31 58 107 20 36 67 87 4 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
93 158 13 31 71 107 6 13 46 65 68 15 18 47 110 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 81 15 20 48 87 10 3 17 40 5 1 0 8 0 90
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
819 901 1222 857
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
468 969 741 1621
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
250 1177 1628 744

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.