Viewing data for Balaenoptera physalus


Scientific name Balaenoptera physalus
Common name Fin whale
Maximum lifespan 114.00 years (Balaenoptera physalus@AnAge)

Total mtDNA (size: 16398 bases) GC AT G C A T
Base content (bases) 6656 9742 4474 2182 4383 5359
Base content per 1 kb (bases) 406 594 273 133 267 327
Base content (%) 40.6% 59.4%
Total protein-coding genes (size: 11349 bases) GC AT G C A T
Base content (bases) 4678 6671 3339 1339 3065 3606
Base content per 1 kb (bases) 412 588 294 118 270 318
Base content (%) 41.2% 58.8%
D-loop (size: 929 bases) GC AT G C A T
Base content (bases) 364 565 217 147 286 279
Base content per 1 kb (bases) 392 608 234 158 308 300
Base content (%) 39.2% 60.8%
Total tRNA-coding genes (size: 1521 bases) GC AT G C A T
Base content (bases) 560 961 323 237 428 533
Base content per 1 kb (bases) 368 632 212 156 281 350
Base content (%) 36.8% 63.2%
Total rRNA-coding genes (size: 2550 bases) GC AT G C A T
Base content (bases) 1031 1519 579 452 595 924
Base content per 1 kb (bases) 404 596 227 177 233 362
Base content (%) 40.4% 59.6%
12S rRNA gene (size: 976 bases) GC AT G C A T
Base content (bases) 423 553 238 185 212 341
Base content per 1 kb (bases) 433 567 244 190 217 349
Base content (%) 43.3% 56.7%
16S rRNA gene (size: 1574 bases) GC AT G C A T
Base content (bases) 608 966 341 267 383 583
Base content per 1 kb (bases) 386 614 217 170 243 370
Base content (%) 38.6% 61.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 265 416 194 71 200 216
Base content per 1 kb (bases) 389 611 285 104 294 317
Base content (%) 38.9% 61.1%
ATP8 (size: 192 bases) GC AT G C A T
Base content (bases) 65 127 54 11 54 73
Base content per 1 kb (bases) 339 661 281 57 281 380
Base content (%) 33.9% 66.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 661 890 408 253 444 446
Base content per 1 kb (bases) 426 574 263 163 286 288
Base content (%) 42.6% 57.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 269 415 175 94 182 233
Base content per 1 kb (bases) 393 607 256 137 266 341
Base content (%) 39.3% 60.7%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 346 440 234 112 222 218
Base content per 1 kb (bases) 440 560 298 142 282 277
Base content (%) 44.0% 56.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 505 635 356 149 291 344
Base content per 1 kb (bases) 443 557 312 131 255 302
Base content (%) 44.3% 55.7%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 406 551 290 116 248 303
Base content per 1 kb (bases) 424 576 303 121 259 317
Base content (%) 42.4% 57.6%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 397 647 305 92 279 368
Base content per 1 kb (bases) 380 620 292 88 267 352
Base content (%) 38.0% 62.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 144 202 103 41 94 108
Base content per 1 kb (bases) 416 584 298 118 272 312
Base content (%) 41.6% 58.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 561 817 418 143 383 434
Base content per 1 kb (bases) 407 593 303 104 278 315
Base content (%) 40.7% 59.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 122 175 84 38 92 83
Base content per 1 kb (bases) 411 589 283 128 310 279
Base content (%) 41.1% 58.9%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 753 1068 562 191 491 577
Base content per 1 kb (bases) 414 586 309 105 270 317
Base content (%) 41.4% 58.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 201 327 167 34 103 224
Base content per 1 kb (bases) 381 619 316 64 195 424
Base content (%) 38.1% 61.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 40 (17.7%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 4 (1.77%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 13 (5.75%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 8 6 6 18 0 10 7 1 2 1 7 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 6 6 5 0 1 4 4 0 5 4 4 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 3 1 5 0 2 1 0 2 0 0 5 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 0 1 5 0 0 2 1 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 62 84 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 66 40 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 66 92 59
ATP8 (size: 192 bases)
Amino acid sequence: MPQLDTSMWLLTILSMLLTLFVLFQLKISKHSYSPNPKLAHTKTQKQQAPWNTTWTKIYLPLL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.17%)
Serine (Ser, S)
n = 5 (7.94%)
Threonine (Thr, T)
n = 8 (12.7%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.59%)
Leucine (Leu, L)
n = 13 (20.63%)
Isoleucine (Ile, I)
n = 3 (4.76%)
Methionine (Met, M)
n = 3 (4.76%)
Proline (Pro, P)
n = 5 (7.94%)
Phenylalanine (Phe, F)
n = 2 (3.17%)
Tyrosine (Tyr, Y)
n = 2 (3.17%)
Tryptophan (Trp, W)
n = 3 (4.76%)
Aspartic acid (Asp, D)
n = 1 (1.59%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.17%)
Glutamine (Gln, Q)
n = 5 (7.94%)
Histidine (His, H)
n = 2 (3.17%)
Lysine (Lys, K)
n = 6 (9.52%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 2 2 3 2 0 5 5 0 0 0 1 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 1 0 0 0 0 0 2 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 1 0 2 3 0 0 0 2 0 0 1 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 1 0 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 19 22 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 20 19 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 15 32 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.3%)
Alanine (Ala, A)
n = 39 (7.56%)
Serine (Ser, S)
n = 31 (6.01%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.36%)
Leucine (Leu, L)
n = 60 (11.63%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 32 (6.2%)
Proline (Pro, P)
n = 29 (5.62%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 18 (3.49%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 19 (3.68%)
Glutamine (Gln, Q)
n = 6 (1.16%)
Histidine (His, H)
n = 17 (3.29%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 25 7 4 29 4 16 5 1 6 11 18 3 11 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 7 15 17 0 9 16 17 6 13 6 10 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 22 0 4 8 16 0 1 2 8 10 0 0 6 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 3 4 11 8 1 1 2 5 0 1 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 104 140 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 135 93 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 169 213 110
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 13 2 5 15 0 10 6 0 3 6 7 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 0 4 4 0 2 3 3 0 2 4 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 0 2 3 10 0 2 3 6 3 1 2 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 12 3 4 7 4 1 0 1 4 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 54 64 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 54 59 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 67 110 41
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 13 (4.98%)
Serine (Ser, S)
n = 21 (8.05%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.75%)
Leucine (Leu, L)
n = 34 (13.03%)
Isoleucine (Ile, I)
n = 16 (6.13%)
Methionine (Met, M)
n = 9 (3.45%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.07%)
Asparagine (Asn, N)
n = 7 (2.68%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 7 (2.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 8 6 5 14 0 7 7 0 1 5 9 0 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 2 8 3 0 1 12 6 1 4 4 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 4 3 10 0 0 4 2 9 1 2 2 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 1 2 2 1 2 2 3 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 67 61 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 64 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 103 101 50
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 19 (5.01%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 25 15 5 12 34 1 6 5 1 2 9 7 1 7 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 7 16 0 3 14 6 1 0 9 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 0 3 6 8 0 2 2 3 12 3 1 5 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 1 4 8 9 0 0 1 8 0 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 103 110 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 93 76 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 160 158 52
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 30 (9.43%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 25 (7.86%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.46%)
Leucine (Leu, L)
n = 58 (18.24%)
Isoleucine (Ile, I)
n = 25 (7.86%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 19 (5.97%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 14 (4.4%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 5 (1.57%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 14 3 12 29 2 11 6 1 0 1 10 0 4 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 14 14 0 0 7 4 1 4 10 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 15 1 0 8 10 0 1 2 4 7 0 1 3 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 2 1 5 2 0 1 6 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 88 93 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 95 59 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 107 151 45
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 20 (5.76%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 65 (18.73%)
Isoleucine (Ile, I)
n = 32 (9.22%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 19 29 6 13 29 3 13 11 0 1 3 5 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 11 6 0 3 4 6 1 3 8 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 25 1 3 8 9 2 0 1 2 6 0 1 7 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 1 0 11 1 1 0 2 1 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 92 140 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 109 58 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 104 170 59
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 20 (5.76%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 65 (18.73%)
Isoleucine (Ile, I)
n = 32 (9.22%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 19 29 6 13 29 3 13 11 0 1 3 5 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 11 6 0 3 4 6 1 3 8 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 25 1 3 8 9 2 0 1 2 6 0 1 7 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 1 0 11 1 1 0 2 1 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 92 140 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 109 58 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 104 170 59
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 25 (5.46%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 23 30 11 24 44 3 13 11 0 2 6 7 0 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 3 15 12 0 0 8 9 1 6 11 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 2 6 12 8 2 4 7 8 8 1 2 10 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 1 0 3 11 0 2 2 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 140 152 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 118 85 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 160 197 88
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 8 4 5 9 0 4 2 0 2 2 1 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 2 4 4 0 2 1 1 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 1 3 2 0 0 2 2 1 0 1 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 25 30 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 22 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 37 36 20
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 42 (6.93%)
Threonine (Thr, T)
n = 60 (9.9%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 102 (16.83%)
Isoleucine (Ile, I)
n = 54 (8.91%)
Methionine (Met, M)
n = 31 (5.12%)
Proline (Pro, P)
n = 30 (4.95%)
Phenylalanine (Phe, F)
n = 45 (7.43%)
Tyrosine (Tyr, Y)
n = 16 (2.64%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 37 29 16 23 40 6 16 19 1 3 5 9 0 14 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 3 6 19 16 0 3 8 16 1 7 13 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 26 1 7 14 10 2 3 6 7 9 0 1 9 25 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 1 5 6 18 4 1 4 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 158 210 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 164 131 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 240 236 112
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.43%)
Alanine (Ala, A)
n = 7 (4.0%)
Serine (Ser, S)
n = 15 (8.57%)
Threonine (Thr, T)
n = 7 (4.0%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 27 (15.43%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 18 (10.29%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 0 1 0 0 2 1 7 0 1 14 0 5 8 12 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 4 0 2 1 11 0 5 11 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 4 0 2 1 8 0 9 0 4 8 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 7 2 1 1 3 0 0 0 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 8 46 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 24 27 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 2 30 90
Total protein-coding genes (size: 11405 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 254 (6.68%)
Serine (Ser, S)
n = 264 (6.95%)
Threonine (Thr, T)
n = 328 (8.63%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 186 (4.89%)
Leucine (Leu, L)
n = 631 (16.61%)
Isoleucine (Ile, I)
n = 314 (8.26%)
Methionine (Met, M)
n = 228 (6.0%)
Proline (Pro, P)
n = 204 (5.37%)
Phenylalanine (Phe, F)
n = 237 (6.24%)
Tyrosine (Tyr, Y)
n = 123 (3.24%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 159 (4.18%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 66 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
137 177 187 72 117 279 20 122 86 7 36 49 88 13 86 151
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 10 13 41 109 103 1 35 78 79 23 51 74 78 1 62
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
91 167 8 37 70 95 7 23 32 55 68 10 21 50 109 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
73 74 21 25 42 81 14 7 16 38 5 2 0 7 2 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
817 953 1181 850
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
467 995 743 1596
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
194 1269 1582 756

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.