Viewing data for Arripis trutta


Scientific name Arripis trutta
Common name Australian salmon
Maximum lifespan 26.00 years (Arripis trutta@AnAge)

Total mtDNA (size: 17244 bases) GC AT G C A T
Base content (bases) 7678 9566 4835 2843 4680 4886
Base content per 1 kb (bases) 445 555 280 165 271 283
Base content (%) 44.5% 55.5%
Total protein-coding genes (size: 11422 bases) GC AT G C A T
Base content (bases) 5342 6080 3551 1791 3144 2936
Base content per 1 kb (bases) 468 532 311 157 275 257
Base content (%) 46.8% 53.2%
D-loop (size: 1413 bases) GC AT G C A T
Base content (bases) 336 1077 200 136 502 575
Base content per 1 kb (bases) 238 762 142 96 355 407
Base content (%) 23.8% 76.2%
Total tRNA-coding genes (size: 1552 bases) GC AT G C A T
Base content (bases) 699 853 377 322 392 461
Base content per 1 kb (bases) 450 550 243 207 253 297
Base content (%) 45.0% 55.0%
Total rRNA-coding genes (size: 2698 bases) GC AT G C A T
Base content (bases) 1229 1469 668 561 596 873
Base content per 1 kb (bases) 456 544 248 208 221 324
Base content (%) 45.6% 54.4%
12S rRNA gene (size: 1002 bases) GC AT G C A T
Base content (bases) 458 544 246 212 228 316
Base content per 1 kb (bases) 457 543 246 212 228 315
Base content (%) 45.7% 54.3%
16S rRNA gene (size: 1696 bases) GC AT G C A T
Base content (bases) 771 925 422 349 368 557
Base content per 1 kb (bases) 455 545 249 206 217 328
Base content (%) 45.5% 54.5%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 319 364 226 93 197 167
Base content per 1 kb (bases) 467 533 331 136 288 245
Base content (%) 46.7% 53.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 77 91 58 19 42 49
Base content per 1 kb (bases) 458 542 345 113 250 292
Base content (%) 45.8% 54.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 692 859 412 280 472 387
Base content per 1 kb (bases) 446 554 266 181 304 250
Base content (%) 44.6% 55.4%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 296 395 184 112 200 195
Base content per 1 kb (bases) 428 572 266 162 289 282
Base content (%) 42.8% 57.2%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 377 408 243 134 214 194
Base content per 1 kb (bases) 480 520 310 171 273 247
Base content (%) 48.0% 52.0%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 536 605 359 177 335 270
Base content per 1 kb (bases) 470 530 315 155 294 237
Base content (%) 47.0% 53.0%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 458 517 312 146 277 240
Base content per 1 kb (bases) 470 530 320 150 284 246
Base content (%) 47.0% 53.0%
ND2 (size: 1046 bases) GC AT G C A T
Base content (bases) 511 535 361 150 274 261
Base content per 1 kb (bases) 489 511 345 143 262 250
Base content (%) 48.9% 51.1%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 160 189 105 55 113 76
Base content per 1 kb (bases) 458 542 301 158 324 218
Base content (%) 45.8% 54.2%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 650 731 428 222 368 363
Base content per 1 kb (bases) 471 529 310 161 266 263
Base content (%) 47.1% 52.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 96 50 87 64
Base content per 1 kb (bases) 492 508 323 168 293 215
Base content (%) 49.2% 50.8%
ND5 (size: 1854 bases) GC AT G C A T
Base content (bases) 879 975 604 275 485 490
Base content per 1 kb (bases) 474 526 326 148 262 264
Base content (%) 47.4% 52.6%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 246 276 165 81 88 188
Base content per 1 kb (bases) 471 529 316 155 169 360
Base content (%) 47.1% 52.9%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 57 (25.22%)
Isoleucine (Ile, I)
n = 17 (7.52%)
Methionine (Met, M)
n = 8 (3.54%)
Proline (Pro, P)
n = 17 (7.52%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 7 (3.1%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 4 4 18 12 13 5 8 6 2 2 5 5 1 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 8 3 2 2 6 1 0 5 6 4 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 8 1 1 2 1 0 0 5 1 2 0 1 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 1 0 1 1 0 0 2 3 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 83 65 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 64 33 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 79 68 60
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPTPWFPIMAFSWLVFLIVLPPKIIAHATPNVPTPLSARKEKGNTWNWPWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 4 (7.27%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 1 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 1 2 0 1 0 3 1 0 1 1 1 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 4 0 0 0 1 0 0 1 7 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 0 1 0 0 0 1 0 0 0 1 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 0 3 0 0 0 1 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
9 16 18 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 19 11 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 23 20 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 49 (9.5%)
Serine (Ser, S)
n = 29 (5.62%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.53%)
Leucine (Leu, L)
n = 61 (11.82%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 27 (5.23%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 16 12 15 9 23 1 9 5 2 14 10 19 1 18 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 16 19 13 1 9 16 15 7 10 9 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 2 8 7 9 0 0 5 10 9 2 4 6 8 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 3 4 11 8 0 1 2 4 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
166 109 126 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 166 167 148
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.37%)
Alanine (Ala, A)
n = 18 (7.86%)
Serine (Ser, S)
n = 18 (7.86%)
Threonine (Thr, T)
n = 8 (3.49%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 23 (10.04%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 10 (4.37%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 7 (3.06%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 9 7 7 7 5 0 6 7 0 5 6 5 2 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 6 8 0 3 1 4 2 3 7 2 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 5 4 5 0 3 1 4 5 0 1 4 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 1 4 9 3 1 1 2 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 55 55 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 54 62 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 75 78 65
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 30 (11.54%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 6 5 5 7 13 1 4 5 3 3 6 6 1 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 1 15 7 0 3 6 9 3 4 5 3 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 1 4 4 4 0 0 3 4 8 0 0 0 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 3 2 4 2 0 1 1 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 68 53 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 72 53 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 103 87 55
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 31 (8.18%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 25 (6.6%)
Leucine (Leu, L)
n = 62 (16.36%)
Isoleucine (Ile, I)
n = 29 (7.65%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 32 (8.44%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 18 3 10 23 12 3 13 5 1 7 6 9 3 14 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 6 13 11 1 7 9 8 2 6 9 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 6 1 3 12 8 2 0 1 3 10 2 1 0 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 2 3 7 8 1 1 1 4 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 95 86 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 98 74 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 166 110 77
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 18 (5.56%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 18 (5.56%)
Leucine (Leu, L)
n = 62 (19.14%)
Isoleucine (Ile, I)
n = 26 (8.02%)
Methionine (Met, M)
n = 10 (3.09%)
Proline (Pro, P)
n = 25 (7.72%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 7 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 18 8 18 15 17 2 7 5 2 4 7 4 3 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 7 16 10 1 3 6 6 3 5 11 8 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 1 1 7 10 1 0 2 3 8 2 3 5 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 3 1 3 6 1 1 1 4 1 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 96 75 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 96 58 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 120 107 72
ND2 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 39 (11.24%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 45 (12.97%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 72 (20.75%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 15 (4.32%)
Proline (Pro, P)
n = 23 (6.63%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 9 9 17 24 20 3 6 9 4 5 3 3 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 10 17 9 3 3 8 4 4 7 7 7 2 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 11 2 2 9 5 2 1 4 3 6 4 2 2 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 2 9 0 1 0 3 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 110 102 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 125 52 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 126 106 82
ND3 (size: 1046 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.48%)
Alanine (Ala, A)
n = 39 (11.24%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 45 (12.97%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.46%)
Leucine (Leu, L)
n = 72 (20.75%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 15 (4.32%)
Proline (Pro, P)
n = 23 (6.63%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 9 9 17 24 20 3 6 9 4 5 3 3 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 10 17 9 3 3 8 4 4 7 7 7 2 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 11 2 2 9 5 2 1 4 3 6 4 2 2 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 0 2 9 0 1 0 3 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 110 102 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 125 52 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 126 106 82
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 43 (9.37%)
Serine (Ser, S)
n = 27 (5.88%)
Threonine (Thr, T)
n = 46 (10.02%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 15 (3.27%)
Leucine (Leu, L)
n = 99 (21.57%)
Isoleucine (Ile, I)
n = 32 (6.97%)
Methionine (Met, M)
n = 24 (5.23%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 17 (3.7%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 12 (2.61%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 12 15 24 21 30 11 11 9 3 4 5 4 2 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 6 8 17 15 3 2 7 11 6 8 9 8 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 15 6 3 9 5 1 3 6 3 11 3 2 4 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 2 1 4 7 2 1 2 5 3 0 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
99 147 132 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 133 74 184
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 148 157 101
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (7.14%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 2 4 6 6 2 2 3 0 0 0 1 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 3 5 4 0 1 2 2 2 1 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 2 3 4 2 0 1 0 0 0 3 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 1 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 30 18 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 32 13 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 34 33 20
ND5 (size: 1854 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.7%)
Alanine (Ala, A)
n = 59 (9.56%)
Serine (Ser, S)
n = 48 (7.78%)
Threonine (Thr, T)
n = 57 (9.24%)
Cysteine (Cys, C)
n = 6 (0.97%)
Valine (Val, V)
n = 34 (5.51%)
Leucine (Leu, L)
n = 93 (15.07%)
Isoleucine (Ile, I)
n = 45 (7.29%)
Methionine (Met, M)
n = 29 (4.7%)
Proline (Pro, P)
n = 38 (6.16%)
Phenylalanine (Phe, F)
n = 42 (6.81%)
Tyrosine (Tyr, Y)
n = 13 (2.11%)
Tryptophan (Trp, W)
n = 12 (1.94%)
Aspartic acid (Asp, D)
n = 13 (2.11%)
Glutamic acid (Glu, E)
n = 11 (1.78%)
Asparagine (Asn, N)
n = 29 (4.7%)
Glutamine (Gln, Q)
n = 17 (2.76%)
Histidine (His, H)
n = 8 (1.3%)
Lysine (Lys, K)
n = 20 (3.24%)
Arginine (Arg, R)
n = 14 (2.27%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 26 18 22 23 24 12 12 14 3 6 15 9 4 9 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 1 5 12 27 18 2 3 13 7 6 17 13 6 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 19 3 6 15 10 2 3 12 3 10 2 0 7 22 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 1 2 11 17 3 0 4 8 2 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 158 195 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 187 112 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 259 183 123
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.29%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 7 (4.05%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 24 (13.87%)
Leucine (Leu, L)
n = 29 (16.76%)
Isoleucine (Ile, I)
n = 6 (3.47%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 10 (5.78%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 2 1 3 2 2 14 0 0 6 4 5 9 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 0 6 5 2 4 4 4 4 11 3 1 0 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 3 3 1 3 0 2 1 6 3 2 7 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 2 1 0 0 0 0 2 2 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 18 26 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 37 21 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 26 41 54
Total protein-coding genes (size: 11443 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 242 (6.35%)
Alanine (Ala, A)
n = 358 (9.4%)
Serine (Ser, S)
n = 248 (6.51%)
Threonine (Thr, T)
n = 307 (8.06%)
Cysteine (Cys, C)
n = 28 (0.73%)
Valine (Val, V)
n = 226 (5.93%)
Leucine (Leu, L)
n = 646 (16.96%)
Isoleucine (Ile, I)
n = 266 (6.98%)
Methionine (Met, M)
n = 155 (4.07%)
Proline (Pro, P)
n = 230 (6.04%)
Phenylalanine (Phe, F)
n = 235 (6.17%)
Tyrosine (Tyr, Y)
n = 114 (2.99%)
Tryptophan (Trp, W)
n = 116 (3.04%)
Aspartic acid (Asp, D)
n = 77 (2.02%)
Glutamic acid (Glu, E)
n = 99 (2.6%)
Asparagine (Asn, N)
n = 117 (3.07%)
Glutamine (Gln, Q)
n = 92 (2.41%)
Histidine (His, H)
n = 96 (2.52%)
Lysine (Lys, K)
n = 73 (1.92%)
Arginine (Arg, R)
n = 80 (2.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
141 125 88 150 155 174 44 99 70 22 58 69 72 27 93 142
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
67 8 20 82 157 102 17 40 82 73 47 73 86 56 15 69
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
111 107 20 42 75 66 10 14 41 40 74 18 24 33 84 32
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
64 76 23 19 58 65 8 8 17 42 13 0 0 6 0 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1002 1021 973 815
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
521 1088 674 1528
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
355 1360 1194 902

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.