Viewing data for Hemignathus munroi


Scientific name Hemignathus munroi
Common name Akiapolaau
Maximum lifespan 13.00 years (Hemignathus munroi@AnAge)

Total mtDNA (size: 15311 bases) GC AT G C A T
Base content (bases) 6946 8361 4894 2052 3704 4657
Base content per 1 kb (bases) 454 546 320 134 242 304
Base content (%) 45.4% 54.6%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5264 6113 3852 1412 2707 3406
Base content per 1 kb (bases) 463 537 339 124 238 299
Base content (%) 46.3% 53.7%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1470 bases) GC AT G C A T
Base content (bases) 610 860 357 253 377 483
Base content per 1 kb (bases) 415 585 243 172 256 329
Base content (%) 41.5% 58.5%
Total rRNA-coding genes (size: 1132 bases) GC AT G C A T
Base content (bases) 499 631 278 221 255 376
Base content per 1 kb (bases) 441 557 246 195 225 332
Base content (%) 44.1% 55.7%
12S rRNA gene (size: 71 bases) GC AT G C A T
Base content (bases) 28 41 15 13 23 18
Base content per 1 kb (bases) 394 577 211 183 324 254
Base content (%) 39.4% 57.7%
16S rRNA gene (size: 1061 bases) GC AT G C A T
Base content (bases) 471 590 263 208 232 358
Base content per 1 kb (bases) 444 556 248 196 219 337
Base content (%) 44.4% 55.6%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 309 375 244 65 161 214
Base content per 1 kb (bases) 452 548 357 95 235 313
Base content (%) 45.2% 54.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 75 93 63 12 44 49
Base content per 1 kb (bases) 446 554 375 71 262 292
Base content (%) 44.6% 55.4%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 740 811 486 254 381 430
Base content per 1 kb (bases) 477 523 313 164 246 277
Base content (%) 47.7% 52.3%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 313 371 209 104 162 209
Base content per 1 kb (bases) 457 542 305 152 236 305
Base content (%) 45.7% 54.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 376 408 252 124 194 214
Base content per 1 kb (bases) 480 520 321 158 247 273
Base content (%) 48.0% 52.0%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 541 602 393 148 271 331
Base content per 1 kb (bases) 473 527 344 129 237 290
Base content (%) 47.3% 52.7%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 441 537 299 142 280 257
Base content per 1 kb (bases) 451 549 306 145 286 263
Base content (%) 45.1% 54.9%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 454 586 354 100 262 324
Base content per 1 kb (bases) 437 563 340 96 252 312
Base content (%) 43.7% 56.3%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 160 191 115 45 92 99
Base content per 1 kb (bases) 456 544 328 128 262 282
Base content (%) 45.6% 54.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 643 735 494 149 312 423
Base content per 1 kb (bases) 467 533 358 108 226 307
Base content (%) 46.7% 53.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 143 154 109 34 73 81
Base content per 1 kb (bases) 481 519 367 114 246 273
Base content (%) 48.1% 51.9%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 823 994 627 196 422 572
Base content per 1 kb (bases) 453 547 345 108 232 315
Base content (%) 45.3% 54.7%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 251 268 210 41 57 211
Base content per 1 kb (bases) 484 516 405 79 110 407
Base content (%) 48.4% 51.6%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 60 (26.43%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 15 5 3 13 40 1 3 8 0 1 3 5 0 0 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 10 4 0 0 4 4 0 3 4 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 1 1 4 6 0 0 4 1 2 0 0 0 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 1 2 4 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 89 66 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 90 113 20
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWLTFSFIIQPKLLSFVSMNPPSNKPPATPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 5 (9.09%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 1 0 2 2 0 0 2 0 0 0 1 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 1 0 0 0 0 0 3 4 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 0 0 0 2 2 1 0 1 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 17 20 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 24 8 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 22 21 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.95%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 23 (4.46%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 26 18 7 14 39 2 2 9 0 3 17 18 3 6 37
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 7 23 16 0 6 11 27 3 3 11 14 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 16 0 5 8 11 0 0 4 7 10 0 0 3 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 1 2 13 9 0 2 1 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 128 126 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 221 210 69
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 22 (9.69%)
Threonine (Thr, T)
n = 14 (6.17%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 10 11 5 8 10 4 2 6 0 3 5 7 1 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 3 8 7 0 0 1 8 0 1 4 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 7 0 6 5 6 0 0 5 1 6 0 0 2 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 4 9 3 1 1 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 60 58 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 61 57 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 88 93 37
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 13 (5.0%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 11 4 4 6 19 4 1 9 0 2 5 7 1 3 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 11 10 0 2 6 12 0 2 5 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 0 4 6 4 0 1 3 0 10 1 0 2 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 1 0 5 4 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 75 54 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 71 54 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 106 106 39
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 23 (6.05%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 35 (9.21%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 26 6 5 16 35 4 3 8 0 3 5 13 2 3 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 3 17 7 1 2 8 13 1 2 11 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 1 1 11 9 0 0 1 1 11 0 0 3 18 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 1 7 10 0 1 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 112 100 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 99 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 182 152 37
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 16 (4.92%)
Leucine (Leu, L)
n = 68 (20.92%)
Isoleucine (Ile, I)
n = 22 (6.77%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 10 7 10 13 30 8 7 5 1 1 4 7 4 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 7 11 11 2 2 5 6 0 8 10 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 0 5 7 8 0 3 3 6 10 3 0 5 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 1 3 5 2 2 1 5 0 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 101 79 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 93 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 105 118 75
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 23 (6.67%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 22 (6.38%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 19 15 6 23 26 3 7 8 2 0 5 2 0 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 5 6 12 0 1 4 5 2 4 9 8 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 12 1 3 13 10 1 0 6 4 3 0 1 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 2 0 1 14 0 1 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 102 131 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 115 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 137 134 56
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 23 (6.67%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 44 (12.75%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 22 (6.38%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 19 15 6 23 26 3 7 8 2 0 5 2 0 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 5 6 12 0 1 4 5 2 4 9 8 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 12 1 3 13 10 1 0 6 4 3 0 1 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 2 0 1 14 0 1 1 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 102 131 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 115 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 137 134 56
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 38 (8.3%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 45 (9.83%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 24 (5.24%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 33 17 5 30 55 2 7 12 2 1 5 4 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 10 13 14 1 2 9 4 3 4 13 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 21 0 4 12 12 1 0 8 0 13 0 0 1 16 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 0 0 2 10 0 0 1 10 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 158 146 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 139 80 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 197 197 47
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 6 2 3 14 0 0 4 0 0 0 2 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 6 2 0 1 3 0 0 1 0 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 1 6 2 0 0 4 0 3 0 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 1 0 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 33 25 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 47 38 13
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 48 (7.93%)
Serine (Ser, S)
n = 55 (9.09%)
Threonine (Thr, T)
n = 63 (10.41%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 100 (16.53%)
Isoleucine (Ile, I)
n = 56 (9.26%)
Methionine (Met, M)
n = 30 (4.96%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 38 (6.28%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 28 (4.63%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 19 (3.14%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 40 26 6 24 63 2 5 16 1 4 3 8 1 4 34
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 6 4 28 16 0 0 10 23 0 5 17 8 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 23 0 6 24 15 0 0 10 2 11 0 0 3 25 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 13 0 1 7 19 0 1 1 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
118 161 207 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 186 109 240
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 280 254 63
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.02%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 14 (8.14%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 33 (19.19%)
Leucine (Leu, L)
n = 31 (18.02%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 3 (1.74%)
Phenylalanine (Phe, F)
n = 10 (5.81%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 5 (2.91%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 5 0 0 1 7 0 0 15 0 0 18 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 5 0 2 5 5 0 6 20 1 0 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 6 0 1 4 3 0 7 0 4 18 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 3 0 0 0 0 0 1 3 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 13 16 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 28 19 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
82 0 22 69
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.9%)
Alanine (Ala, A)
n = 302 (7.96%)
Serine (Ser, S)
n = 297 (7.82%)
Threonine (Thr, T)
n = 314 (8.27%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 191 (5.03%)
Leucine (Leu, L)
n = 669 (17.62%)
Isoleucine (Ile, I)
n = 295 (7.77%)
Methionine (Met, M)
n = 164 (4.32%)
Proline (Pro, P)
n = 221 (5.82%)
Phenylalanine (Phe, F)
n = 219 (5.77%)
Tyrosine (Tyr, Y)
n = 110 (2.9%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 137 (3.61%)
Glutamine (Gln, Q)
n = 96 (2.53%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 84 (2.21%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
88 207 121 61 159 352 34 44 90 6 33 52 75 31 44 175
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 5 23 51 137 105 9 21 61 112 30 39 89 89 4 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
125 124 4 43 101 89 7 7 50 30 80 10 19 24 113 19
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
80 79 13 13 53 81 3 10 11 47 3 2 1 5 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
875 1093 1054 773
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1077 690 1538
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
218 1516 1512 549

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.