Viewing data for Callimico goeldii


Scientific name Callimico goeldii
Common name Goeldi's monkey
Maximum lifespan 22.20 years (Callimico goeldii@AnAge)

Total mtDNA (size: 16523 bases) GC AT G C A T
Base content (bases) 6286 10237 4162 2124 4739 5498
Base content per 1 kb (bases) 380 620 252 129 287 333
Base content (%) 38.0% 62.0%
Total protein-coding genes (size: 11355 bases) GC AT G C A T
Base content (bases) 4279 7076 2983 1296 3400 3676
Base content per 1 kb (bases) 377 623 263 114 299 324
Base content (%) 37.7% 62.3%
D-loop (size: 1100 bases) GC AT G C A T
Base content (bases) 438 662 282 156 297 365
Base content per 1 kb (bases) 398 602 256 142 270 332
Base content (%) 39.8% 60.2%
Total tRNA-coding genes (size: 1503 bases) GC AT G C A T
Base content (bases) 540 963 316 224 425 538
Base content per 1 kb (bases) 359 641 210 149 283 358
Base content (%) 35.9% 64.1%
Total rRNA-coding genes (size: 2508 bases) GC AT G C A T
Base content (bases) 1006 1502 564 442 602 900
Base content per 1 kb (bases) 401 599 225 176 240 359
Base content (%) 40.1% 59.9%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 405 550 223 182 217 333
Base content per 1 kb (bases) 424 576 234 191 227 349
Base content (%) 42.4% 57.6%
16S rRNA gene (size: 1553 bases) GC AT G C A T
Base content (bases) 601 952 341 260 385 567
Base content per 1 kb (bases) 387 613 220 167 248 365
Base content (%) 38.7% 61.3%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 251 430 183 68 213 217
Base content per 1 kb (bases) 369 631 269 100 313 319
Base content (%) 36.9% 63.1%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 67 140 51 16 59 81
Base content per 1 kb (bases) 324 676 246 77 285 391
Base content (%) 32.4% 67.6%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 610 947 364 246 502 445
Base content per 1 kb (bases) 392 608 234 158 322 286
Base content (%) 39.2% 60.8%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 259 429 165 94 213 216
Base content per 1 kb (bases) 376 624 240 137 310 314
Base content (%) 37.6% 62.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 328 456 211 117 231 225
Base content per 1 kb (bases) 418 582 269 149 295 287
Base content (%) 41.8% 58.2%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 455 685 320 135 343 342
Base content per 1 kb (bases) 399 601 281 118 301 300
Base content (%) 39.9% 60.1%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 372 583 273 99 274 309
Base content per 1 kb (bases) 390 610 286 104 287 324
Base content (%) 39.0% 61.0%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 353 686 280 73 297 389
Base content per 1 kb (bases) 340 660 269 70 286 374
Base content (%) 34.0% 66.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 125 221 90 35 107 114
Base content per 1 kb (bases) 361 639 260 101 309 329
Base content (%) 36.1% 63.9%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 506 869 360 146 412 457
Base content per 1 kb (bases) 368 632 262 106 300 332
Base content (%) 36.8% 63.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 95 202 64 31 109 93
Base content per 1 kb (bases) 320 680 215 104 367 313
Base content (%) 32.0% 68.0%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 681 1125 494 187 539 586
Base content per 1 kb (bases) 377 623 274 104 298 324
Base content (%) 37.7% 62.3%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 194 340 141 53 119 221
Base content per 1 kb (bases) 363 637 264 99 223 414
Base content (%) 36.3% 63.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 28 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 47 (20.8%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 8 (3.54%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 6 (2.65%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 4 8 11 7 16 4 9 9 0 3 0 7 1 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 4 6 0 3 2 3 1 3 5 5 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 15 0 4 5 3 0 1 1 2 2 1 0 6 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 2 6 0 0 0 4 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 70 81 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 68 40 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 45 96 75
ATP8 (size: 207 bases)
Amino acid sequence: MPQLNISPWPMVILSMVVTLFYITQLKMLGFTFHMMLSPKLTEMQKHKTTWELKWTKIYLPPLTFPQS*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.47%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (5.88%)
Threonine (Thr, T)
n = 8 (11.76%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (4.41%)
Leucine (Leu, L)
n = 10 (14.71%)
Isoleucine (Ile, I)
n = 4 (5.88%)
Methionine (Met, M)
n = 7 (10.29%)
Proline (Pro, P)
n = 7 (10.29%)
Phenylalanine (Phe, F)
n = 4 (5.88%)
Tyrosine (Tyr, Y)
n = 2 (2.94%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.94%)
Asparagine (Asn, N)
n = 1 (1.47%)
Glutamine (Gln, Q)
n = 4 (5.88%)
Histidine (His, H)
n = 2 (2.94%)
Lysine (Lys, K)
n = 6 (8.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 5 1 0 4 1 3 4 0 1 1 0 1 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 1 0 0 0 3 0 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 1 0 3 0 0 0 2 0 0 1 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 0 6 0 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 19 26 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 19 18 28
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 13 37 13
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.88%)
Alanine (Ala, A)
n = 37 (7.14%)
Serine (Ser, S)
n = 36 (6.95%)
Threonine (Thr, T)
n = 39 (7.53%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.14%)
Leucine (Leu, L)
n = 61 (11.78%)
Isoleucine (Ile, I)
n = 38 (7.34%)
Methionine (Met, M)
n = 30 (5.79%)
Proline (Pro, P)
n = 28 (5.41%)
Phenylalanine (Phe, F)
n = 41 (7.92%)
Tyrosine (Tyr, Y)
n = 21 (4.05%)
Tryptophan (Trp, W)
n = 16 (3.09%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 11 (2.12%)
Asparagine (Asn, N)
n = 17 (3.28%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 18 (3.47%)
Lysine (Lys, K)
n = 11 (2.12%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 14 25 8 8 28 2 15 6 1 10 5 19 3 25 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 13 11 13 0 9 16 17 4 11 7 9 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 0 9 4 17 1 1 4 14 7 4 0 8 9 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 0 12 3 10 1 3 1 4 0 0 1 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 107 141 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 135 100 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 122 204 170
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 17 (7.46%)
Threonine (Thr, T)
n = 17 (7.46%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.39%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 23 (10.09%)
Methionine (Met, M)
n = 11 (4.82%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 14 (6.14%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 6 (2.63%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 3 8 8 1 8 0 13 8 0 1 3 6 0 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 7 5 0 4 0 2 2 3 4 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 1 4 4 5 0 1 3 8 6 2 0 4 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 3 4 6 4 0 1 2 3 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 49 65 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 62 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 58 89 71
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 27 (10.38%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 4 10 6 4 10 3 4 7 2 4 4 5 1 14 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 6 6 6 0 2 6 11 1 4 2 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 0 4 2 7 1 0 4 5 8 0 0 3 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 0 2 1 2 0 0 1 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 65 63 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 70 56 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 76 106 68
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 38 (10.03%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 9 (2.37%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 43 (11.35%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 14 (3.69%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 26 12 8 7 26 3 11 7 1 4 1 2 2 13 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 5 10 8 0 3 8 10 2 2 10 9 2 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 6 6 12 0 2 0 4 10 2 2 8 6 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 6 5 9 2 2 0 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 93 121 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 108 76 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 119 145 99
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 26 (8.2%)
Serine (Ser, S)
n = 21 (6.62%)
Threonine (Thr, T)
n = 36 (11.36%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 9 (2.84%)
Leucine (Leu, L)
n = 60 (18.93%)
Isoleucine (Ile, I)
n = 25 (7.89%)
Methionine (Met, M)
n = 17 (5.36%)
Proline (Pro, P)
n = 20 (6.31%)
Phenylalanine (Phe, F)
n = 17 (5.36%)
Tyrosine (Tyr, Y)
n = 16 (5.05%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 1 (0.32%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 16 10 6 30 0 14 7 0 2 1 4 2 12 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 12 9 1 1 8 3 0 2 9 8 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 0 3 4 12 0 1 1 9 7 0 0 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 2 2 1 7 0 0 2 5 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 81 100 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 101 58 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 91 151 69
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 15 (4.35%)
Serine (Ser, S)
n = 27 (7.83%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 55 (15.94%)
Isoleucine (Ile, I)
n = 41 (11.88%)
Methionine (Met, M)
n = 34 (9.86%)
Proline (Pro, P)
n = 25 (7.25%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.38%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 20 33 7 8 25 1 14 10 0 0 0 6 2 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 9 3 0 2 2 7 1 2 8 15 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 23 0 7 4 14 0 0 2 4 5 0 0 11 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 11 0 1 1 1 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 84 150 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 105 62 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 91 177 73
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 15 (4.35%)
Serine (Ser, S)
n = 27 (7.83%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 55 (15.94%)
Isoleucine (Ile, I)
n = 41 (11.88%)
Methionine (Met, M)
n = 34 (9.86%)
Proline (Pro, P)
n = 25 (7.25%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.38%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 20 33 7 8 25 1 14 10 0 0 0 6 2 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 9 3 0 2 2 7 1 2 8 15 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 23 0 7 4 14 0 0 2 4 5 0 0 11 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 0 11 0 1 1 1 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 84 150 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 105 62 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 91 177 73
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.72%)
Alanine (Ala, A)
n = 24 (5.25%)
Serine (Ser, S)
n = 38 (8.32%)
Threonine (Thr, T)
n = 44 (9.63%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 11 (2.41%)
Leucine (Leu, L)
n = 93 (20.35%)
Isoleucine (Ile, I)
n = 36 (7.88%)
Methionine (Met, M)
n = 42 (9.19%)
Proline (Pro, P)
n = 26 (5.69%)
Phenylalanine (Phe, F)
n = 20 (4.38%)
Tyrosine (Tyr, Y)
n = 17 (3.72%)
Tryptophan (Trp, W)
n = 12 (2.63%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 25 (5.47%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 8 (1.75%)
Lysine (Lys, K)
n = 12 (2.63%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 16 37 13 8 46 9 16 8 0 4 0 7 0 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 1 6 8 9 1 1 9 6 1 7 7 11 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 5 3 9 15 1 3 7 12 5 1 1 15 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 3 0 2 10 2 0 1 9 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 128 169 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 122 81 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 110 207 111
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 6 (6.12%)
Threonine (Thr, T)
n = 3 (3.06%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 26 (26.53%)
Isoleucine (Ile, I)
n = 8 (8.16%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 2 11 0 4 12 2 8 2 0 2 0 2 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 3 1 2 1 2 2 0 0 1 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 1 1 4 0 0 0 3 1 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 25 28 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 18 17 55
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 21 48 26
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.33%)
Alanine (Ala, A)
n = 35 (5.82%)
Serine (Ser, S)
n = 57 (9.48%)
Threonine (Thr, T)
n = 63 (10.48%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 17 (2.83%)
Leucine (Leu, L)
n = 83 (13.81%)
Isoleucine (Ile, I)
n = 64 (10.65%)
Methionine (Met, M)
n = 36 (5.99%)
Proline (Pro, P)
n = 29 (4.83%)
Phenylalanine (Phe, F)
n = 49 (8.15%)
Tyrosine (Tyr, Y)
n = 17 (2.83%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 30 (4.99%)
Glutamine (Gln, Q)
n = 20 (3.33%)
Histidine (His, H)
n = 13 (2.16%)
Lysine (Lys, K)
n = 19 (3.16%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 30 32 14 11 41 2 15 19 1 2 3 11 1 20 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 10 10 15 0 4 11 6 5 5 8 16 0 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 28 1 9 12 18 1 5 12 7 10 4 0 17 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 1 2 8 17 2 0 6 2 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 138 229 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 167 120 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 189 237 153
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.12%)
Alanine (Ala, A)
n = 11 (6.21%)
Serine (Ser, S)
n = 9 (5.08%)
Threonine (Thr, T)
n = 12 (6.78%)
Cysteine (Cys, C)
n = 2 (1.13%)
Valine (Val, V)
n = 17 (9.6%)
Leucine (Leu, L)
n = 21 (11.86%)
Isoleucine (Ile, I)
n = 15 (8.47%)
Methionine (Met, M)
n = 14 (7.91%)
Proline (Pro, P)
n = 6 (3.39%)
Phenylalanine (Phe, F)
n = 10 (5.65%)
Tyrosine (Tyr, Y)
n = 10 (5.65%)
Tryptophan (Trp, W)
n = 4 (2.26%)
Aspartic acid (Asp, D)
n = 5 (2.82%)
Glutamic acid (Glu, E)
n = 7 (3.95%)
Asparagine (Asn, N)
n = 3 (1.69%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.13%)
Lysine (Lys, K)
n = 2 (1.13%)
Arginine (Arg, R)
n = 2 (1.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 0 9 3 0 0 0 9 0 0 9 0 5 3 9 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 6 0 4 1 15 1 2 7 5 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 2 3 0 1 1 4 0 9 1 3 9 3 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 5 5 0 1 1 1 0 1 0 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 13 50 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 34 30 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 6 39 94
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 206 (5.42%)
Alanine (Ala, A)
n = 237 (6.24%)
Serine (Ser, S)
n = 275 (7.24%)
Threonine (Thr, T)
n = 368 (9.68%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 151 (3.97%)
Leucine (Leu, L)
n = 598 (15.74%)
Isoleucine (Ile, I)
n = 343 (9.03%)
Methionine (Met, M)
n = 244 (6.42%)
Proline (Pro, P)
n = 209 (5.5%)
Phenylalanine (Phe, F)
n = 237 (6.24%)
Tyrosine (Tyr, Y)
n = 144 (3.79%)
Tryptophan (Trp, W)
n = 103 (2.71%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 91 (2.39%)
Asparagine (Asn, N)
n = 158 (4.16%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 92 (2.42%)
Lysine (Lys, K)
n = 94 (2.47%)
Arginine (Arg, R)
n = 61 (1.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
204 139 210 93 65 260 27 140 90 5 43 18 74 16 125 112
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
34 8 14 67 83 82 5 47 65 70 24 50 63 90 6 98
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
87 174 9 56 51 111 5 18 34 80 64 18 13 83 75 37
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
55 75 16 36 30 85 9 8 14 38 1 0 1 3 3 85
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
751 902 1260 888
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
445 1037 746 1573
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
192 969 1587 1053

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.