Viewing data for Vombatus ursinus


Scientific name Vombatus ursinus
Common name Coarse-haired wombat
Maximum lifespan 30.00 years (Vombatus ursinus@AnAge)

Total mtDNA (size: 16996 bases) GC AT G C A T
Base content (bases) 6732 10264 4578 2154 4564 5700
Base content per 1 kb (bases) 396 604 269 127 269 335
Base content (%) 39.6% 60.4%
Total protein-coding genes (size: 11333 bases) GC AT G C A T
Base content (bases) 4647 6686 3344 1303 3060 3626
Base content per 1 kb (bases) 410 590 295 115 270 320
Base content (%) 41.0% 59.0%
D-loop (size: 1538 bases) GC AT G C A T
Base content (bases) 490 1048 305 185 459 589
Base content per 1 kb (bases) 319 681 198 120 298 383
Base content (%) 31.9% 68.1%
Total tRNA-coding genes (size: 1497 bases) GC AT G C A T
Base content (bases) 545 952 329 216 432 520
Base content per 1 kb (bases) 364 636 220 144 289 347
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2517 bases) GC AT G C A T
Base content (bases) 996 1521 567 429 593 928
Base content per 1 kb (bases) 396 604 225 170 236 369
Base content (%) 39.6% 60.4%
12S rRNA gene (size: 959 bases) GC AT G C A T
Base content (bases) 400 559 225 175 221 338
Base content per 1 kb (bases) 417 583 235 182 230 352
Base content (%) 41.7% 58.3%
16S rRNA gene (size: 1558 bases) GC AT G C A T
Base content (bases) 596 962 342 254 372 590
Base content per 1 kb (bases) 383 617 220 163 239 379
Base content (%) 38.3% 61.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 272 409 208 64 194 215
Base content per 1 kb (bases) 399 601 305 94 285 316
Base content (%) 39.9% 60.1%
ATP8 (size: 210 bases) GC AT G C A T
Base content (bases) 75 135 61 14 46 89
Base content per 1 kb (bases) 357 643 290 67 219 424
Base content (%) 35.7% 64.3%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 640 902 393 247 466 436
Base content per 1 kb (bases) 415 585 255 160 302 283
Base content (%) 41.5% 58.5%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 278 407 185 93 183 224
Base content per 1 kb (bases) 406 594 270 136 267 327
Base content (%) 40.6% 59.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 341 443 233 108 219 224
Base content per 1 kb (bases) 435 565 297 138 279 286
Base content (%) 43.5% 56.5%
CYTB (size: 1146 bases) GC AT G C A T
Base content (bases) 510 636 366 144 296 340
Base content per 1 kb (bases) 445 555 319 126 258 297
Base content (%) 44.5% 55.5%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 385 572 275 110 274 298
Base content per 1 kb (bases) 402 598 287 115 286 311
Base content (%) 40.2% 59.8%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 412 632 321 91 267 365
Base content per 1 kb (bases) 395 605 307 87 256 350
Base content (%) 39.5% 60.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 133 218 93 40 111 107
Base content per 1 kb (bases) 379 621 265 114 316 305
Base content (%) 37.9% 62.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 552 826 419 133 382 444
Base content per 1 kb (bases) 401 599 304 97 277 322
Base content (%) 40.1% 59.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 113 184 76 37 91 93
Base content per 1 kb (bases) 380 620 256 125 306 313
Base content (%) 38.0% 62.0%
ND5 (size: 1812 bases) GC AT G C A T
Base content (bases) 758 1054 569 189 467 587
Base content per 1 kb (bases) 418 582 314 104 258 324
Base content (%) 41.8% 58.2%
ND6 (size: 504 bases) GC AT G C A T
Base content (bases) 198 306 160 38 80 226
Base content per 1 kb (bases) 393 607 317 75 159 448
Base content (%) 39.3% 60.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 26 (11.5%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 7 (3.1%)
Leucine (Leu, L)
n = 40 (17.7%)
Isoleucine (Ile, I)
n = 31 (13.72%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 4 (1.77%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 7 (3.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 19 9 6 7 19 0 8 8 0 1 0 6 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 4 9 3 0 5 2 1 0 4 2 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 1 2 6 3 0 0 3 0 3 0 0 5 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 4 0 2 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 67 86 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 68 34 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 73 95 53
ATP8 (size: 210 bases)
Amino acid sequence: MPQLNTSTWSLTITLMVISLFCIFQLKMMNQTMTSIPPQEDKKLPTKPQLPWDKKWTKIYLPHSSLLQS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 7 (10.14%)
Threonine (Thr, T)
n = 8 (11.59%)
Cysteine (Cys, C)
n = 1 (1.45%)
Valine (Val, V)
n = 1 (1.45%)
Leucine (Leu, L)
n = 10 (14.49%)
Isoleucine (Ile, I)
n = 5 (7.25%)
Methionine (Met, M)
n = 5 (7.25%)
Proline (Pro, P)
n = 7 (10.14%)
Phenylalanine (Phe, F)
n = 2 (2.9%)
Tyrosine (Tyr, Y)
n = 1 (1.45%)
Tryptophan (Trp, W)
n = 3 (4.35%)
Aspartic acid (Asp, D)
n = 2 (2.9%)
Glutamic acid (Glu, E)
n = 1 (1.45%)
Asparagine (Asn, N)
n = 2 (2.9%)
Glutamine (Gln, Q)
n = 6 (8.7%)
Histidine (His, H)
n = 1 (1.45%)
Lysine (Lys, K)
n = 7 (10.14%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 4 0 1 6 1 1 6 0 0 0 1 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 0 0 0 0 0 0 0 0 1 2 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 1 0 1 6 0 0 0 1 0 0 1 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 2 6 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 22 27 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 22 21 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 17 41 6
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.97%)
Alanine (Ala, A)
n = 41 (7.99%)
Serine (Ser, S)
n = 31 (6.04%)
Threonine (Thr, T)
n = 37 (7.21%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.6%)
Leucine (Leu, L)
n = 62 (12.09%)
Isoleucine (Ile, I)
n = 41 (7.99%)
Methionine (Met, M)
n = 27 (5.26%)
Proline (Pro, P)
n = 28 (5.46%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 12 23 4 15 25 3 13 7 0 10 7 21 1 15 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 12 12 15 2 9 16 14 7 8 3 17 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 19 0 5 8 14 0 2 2 7 12 1 2 6 11 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 0 3 12 9 0 3 0 5 0 0 0 0 1 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 107 135 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 94 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 153 207 133
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 14 (6.17%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 11 5 7 13 2 3 9 0 1 6 6 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 2 4 3 0 1 2 4 1 3 3 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 1 3 6 5 0 1 3 10 4 0 1 1 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 3 5 6 5 0 0 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 62 65 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 58 62 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 65 97 52
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 13 (5.0%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 11 9 5 12 12 1 5 8 0 1 3 11 0 5 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 3 5 3 2 4 11 6 0 2 3 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 0 5 14 0 0 3 7 5 0 0 3 3 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 0 1 2 2 0 0 2 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 70 59 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 64 55 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 99 110 48
CYTB (size: 1146 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.56%)
Alanine (Ala, A)
n = 27 (7.09%)
Serine (Ser, S)
n = 22 (5.77%)
Threonine (Thr, T)
n = 26 (6.82%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 16 (4.2%)
Leucine (Leu, L)
n = 58 (15.22%)
Isoleucine (Ile, I)
n = 40 (10.5%)
Methionine (Met, M)
n = 15 (3.94%)
Proline (Pro, P)
n = 24 (6.3%)
Phenylalanine (Phe, F)
n = 26 (6.82%)
Tyrosine (Tyr, Y)
n = 15 (3.94%)
Tryptophan (Trp, W)
n = 12 (3.15%)
Aspartic acid (Asp, D)
n = 10 (2.62%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 17 (4.46%)
Glutamine (Gln, Q)
n = 7 (1.84%)
Histidine (His, H)
n = 12 (3.15%)
Lysine (Lys, K)
n = 11 (2.89%)
Arginine (Arg, R)
n = 8 (2.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 28 13 6 15 29 3 5 6 1 3 3 9 1 5 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 3 12 11 1 3 7 15 0 5 13 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 0 2 11 7 0 1 1 4 11 0 0 5 12 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 0 2 8 11 0 0 3 5 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 104 112 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 97 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 165 149 60
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 27 (8.49%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 24 (7.55%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 15 (4.72%)
Leucine (Leu, L)
n = 58 (18.24%)
Isoleucine (Ile, I)
n = 32 (10.06%)
Methionine (Met, M)
n = 14 (4.4%)
Proline (Pro, P)
n = 18 (5.66%)
Phenylalanine (Phe, F)
n = 19 (5.97%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 10 (3.14%)
Asparagine (Asn, N)
n = 15 (4.72%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 8 (2.52%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 14 11 5 11 27 1 14 6 0 3 7 4 1 3 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 7 14 6 0 2 3 8 0 2 5 11 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 1 2 4 15 0 0 0 7 4 0 0 4 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 8 2 1 3 8 0 0 1 6 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 80 93 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 90 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 105 146 59
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.75%)
Alanine (Ala, A)
n = 26 (7.49%)
Serine (Ser, S)
n = 33 (9.51%)
Threonine (Thr, T)
n = 36 (10.37%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 26 21 7 12 30 2 11 10 1 0 3 4 1 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 12 10 0 1 5 6 1 1 4 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 3 10 17 1 0 2 4 6 0 1 2 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 0 12 0 0 0 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 89 129 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 111 62 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 121 174 43
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.75%)
Alanine (Ala, A)
n = 26 (7.49%)
Serine (Ser, S)
n = 33 (9.51%)
Threonine (Thr, T)
n = 36 (10.37%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 37 (10.66%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 26 21 7 12 30 2 11 10 1 0 3 4 1 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 12 10 0 1 5 6 1 1 4 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 3 10 17 1 0 2 4 6 0 1 2 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 0 12 0 0 0 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 89 129 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 111 62 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 121 174 43
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 44 (9.61%)
Threonine (Thr, T)
n = 42 (9.17%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 86 (18.78%)
Isoleucine (Ile, I)
n = 48 (10.48%)
Methionine (Met, M)
n = 31 (6.77%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 7 (1.53%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 26 29 10 14 49 3 9 7 0 1 2 7 0 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 7 9 10 0 5 10 5 0 6 7 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 18 0 5 14 14 0 3 8 7 10 0 1 5 15 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 1 0 3 12 0 0 2 7 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 131 164 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 123 84 195
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 165 196 90
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 6 1 2 13 1 7 2 0 2 1 3 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 0 1 7 0 0 3 2 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 2 3 5 0 0 1 2 1 0 0 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 2 0 1 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 24 24 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 23 18 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 29 51 15
ND5 (size: 1812 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.64%)
Alanine (Ala, A)
n = 46 (7.63%)
Serine (Ser, S)
n = 43 (7.13%)
Threonine (Thr, T)
n = 57 (9.45%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 15 (2.49%)
Leucine (Leu, L)
n = 84 (13.93%)
Isoleucine (Ile, I)
n = 65 (10.78%)
Methionine (Met, M)
n = 39 (6.47%)
Proline (Pro, P)
n = 32 (5.31%)
Phenylalanine (Phe, F)
n = 39 (6.47%)
Tyrosine (Tyr, Y)
n = 16 (2.65%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 9 (1.49%)
Asparagine (Asn, N)
n = 40 (6.63%)
Glutamine (Gln, Q)
n = 14 (2.32%)
Histidine (His, H)
n = 23 (3.81%)
Lysine (Lys, K)
n = 18 (2.99%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 43 33 11 19 36 6 11 14 0 2 7 6 0 15 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 3 11 19 16 0 4 14 8 2 4 11 17 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 29 1 7 9 16 2 0 9 0 16 1 1 9 31 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 0 3 8 18 0 1 4 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 149 228 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 169 132 242
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 251 227 107
ND6 (size: 504 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.57%)
Alanine (Ala, A)
n = 11 (6.59%)
Serine (Ser, S)
n = 12 (7.19%)
Threonine (Thr, T)
n = 6 (3.59%)
Cysteine (Cys, C)
n = 3 (1.8%)
Valine (Val, V)
n = 26 (15.57%)
Leucine (Leu, L)
n = 27 (16.17%)
Isoleucine (Ile, I)
n = 9 (5.39%)
Methionine (Met, M)
n = 6 (3.59%)
Proline (Pro, P)
n = 3 (1.8%)
Phenylalanine (Phe, F)
n = 12 (7.19%)
Tyrosine (Tyr, Y)
n = 8 (4.79%)
Tryptophan (Trp, W)
n = 4 (2.4%)
Aspartic acid (Asp, D)
n = 3 (1.8%)
Glutamic acid (Glu, E)
n = 9 (5.39%)
Asparagine (Asn, N)
n = 2 (1.2%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (1.2%)
Arginine (Arg, R)
n = 3 (1.8%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 0 2 3 0 1 0 8 0 0 12 1 2 11 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 8 0 1 2 11 0 2 8 2 0 1 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 0 0 0 7 0 7 1 3 15 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 6 3 0 2 0 2 0 0 1 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 10 32 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 25 25 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 3 23 90
Total protein-coding genes (size: 11391 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.61%)
Alanine (Ala, A)
n = 257 (6.77%)
Serine (Ser, S)
n = 286 (7.54%)
Threonine (Thr, T)
n = 313 (8.25%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 175 (4.61%)
Leucine (Leu, L)
n = 607 (15.99%)
Isoleucine (Ile, I)
n = 359 (9.46%)
Methionine (Met, M)
n = 211 (5.56%)
Proline (Pro, P)
n = 201 (5.3%)
Phenylalanine (Phe, F)
n = 223 (5.88%)
Tyrosine (Tyr, Y)
n = 134 (3.53%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 90 (2.37%)
Asparagine (Asn, N)
n = 158 (4.16%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 109 (2.87%)
Lysine (Lys, K)
n = 94 (2.48%)
Arginine (Arg, R)
n = 67 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
159 200 174 67 118 272 23 103 86 2 38 41 80 16 75 148
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
37 11 19 63 101 86 7 46 75 72 20 38 57 106 0 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
95 154 7 38 77 121 3 14 33 59 75 5 24 42 116 44
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
65 77 13 19 48 92 2 8 14 42 3 1 0 5 4 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
802 945 1183 866
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
462 1010 749 1575
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
166 1282 1570 778

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.