Viewing data for Acinonyx jubatus


Scientific name Acinonyx jubatus
Common name Cheetah
Maximum lifespan 20.50 years (Acinonyx jubatus@AnAge)

Total mtDNA (size: 17047 bases) GC AT G C A T
Base content (bases) 6712 10335 4397 2315 4693 5642
Base content per 1 kb (bases) 394 606 258 136 275 331
Base content (%) 39.4% 60.6%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4480 6859 3083 1397 3232 3627
Base content per 1 kb (bases) 395 605 272 123 285 320
Base content (%) 39.5% 60.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1514 bases) GC AT G C A T
Base content (bases) 546 968 315 231 429 539
Base content per 1 kb (bases) 361 639 208 153 283 356
Base content (%) 36.1% 63.9%
Total rRNA-coding genes (size: 3431 bases) GC AT G C A T
Base content (bases) 1367 2064 806 561 840 1224
Base content per 1 kb (bases) 398 602 235 164 245 357
Base content (%) 39.8% 60.2%
12S rRNA gene (size: 960 bases) GC AT G C A T
Base content (bases) 396 564 226 170 212 352
Base content per 1 kb (bases) 413 588 235 177 221 367
Base content (%) 41.3% 58.8%
16S rRNA gene (size: 2471 bases) GC AT G C A T
Base content (bases) 971 1500 580 391 628 872
Base content per 1 kb (bases) 393 607 235 158 254 353
Base content (%) 39.3% 60.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 264 417 186 78 206 211
Base content per 1 kb (bases) 388 612 273 115 302 310
Base content (%) 38.8% 61.2%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 64 140 51 13 55 85
Base content per 1 kb (bases) 314 686 250 64 270 417
Base content (%) 31.4% 68.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 620 925 354 266 503 422
Base content per 1 kb (bases) 401 599 229 172 326 273
Base content (%) 40.1% 59.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 272 412 173 99 189 223
Base content per 1 kb (bases) 398 602 253 145 276 326
Base content (%) 39.8% 60.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 329 455 216 113 230 225
Base content per 1 kb (bases) 420 580 276 144 293 287
Base content (%) 42.0% 58.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 497 643 353 144 305 338
Base content per 1 kb (bases) 436 564 310 126 268 296
Base content (%) 43.6% 56.4%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 383 574 268 115 269 305
Base content per 1 kb (bases) 400 600 280 120 281 319
Base content (%) 40.0% 60.0%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 380 662 289 91 273 389
Base content per 1 kb (bases) 365 635 277 87 262 373
Base content (%) 36.5% 63.5%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 146 200 101 45 98 102
Base content per 1 kb (bases) 422 578 292 130 283 295
Base content (%) 42.2% 57.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 518 860 363 155 404 456
Base content per 1 kb (bases) 376 624 263 112 293 331
Base content (%) 37.6% 62.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 108 189 71 37 98 91
Base content per 1 kb (bases) 364 636 239 125 330 306
Base content (%) 36.4% 63.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 719 1102 523 196 502 600
Base content per 1 kb (bases) 395 605 287 108 276 329
Base content (%) 39.5% 60.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 202 326 151 51 119 207
Base content per 1 kb (bases) 383 617 286 97 225 392
Base content (%) 38.3% 61.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 7 10 5 1 23 4 9 8 1 2 2 6 0 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 7 9 2 0 2 1 6 2 4 4 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 0 1 2 5 1 2 1 2 1 0 1 2 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 1 0 3 1 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 67 79 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 63 39 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 56 93 64
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIMSMIMTLFIVFQLKISKHLYPSNPEPKSMITLEQPNPWEKKWTKIYSPLSLPQQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 7 (10.45%)
Threonine (Thr, T)
n = 6 (8.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 7 (10.45%)
Isoleucine (Ile, I)
n = 7 (10.45%)
Methionine (Met, M)
n = 5 (7.46%)
Proline (Pro, P)
n = 8 (11.94%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 3 (4.48%)
Asparagine (Asn, N)
n = 2 (2.99%)
Glutamine (Gln, Q)
n = 5 (7.46%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 6 (8.96%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 4 1 0 4 1 1 5 0 0 0 1 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 2 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 0 1 5 1 0 0 2 0 0 0 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 1 0 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 20 26 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 21 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 10 38 15
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 61 (11.87%)
Isoleucine (Ile, I)
n = 36 (7.0%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 14 23 10 6 18 7 18 6 0 10 7 17 4 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 1 0 15 11 14 0 10 11 22 4 11 8 8 1 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 17 1 9 3 14 1 2 1 9 10 3 2 12 4 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 4 11 4 8 1 1 1 5 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 101 137 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 94 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 119 191 165
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 6 13 4 3 15 5 5 5 2 1 6 6 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 2 2 0 3 2 2 1 5 3 4 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 2 4 3 7 0 2 3 7 4 0 2 2 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 14 1 1 9 4 1 0 1 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 60 67 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 53 62 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 60 94 55
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 7 8 6 7 15 0 6 7 0 7 2 6 0 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 5 7 3 0 1 5 11 3 0 5 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 2 3 5 8 0 0 4 8 5 1 0 3 4 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 0 2 1 3 0 0 1 4 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 68 62 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 82 106 64
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 22 15 3 14 29 2 8 5 1 3 7 7 0 8 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 1 11 9 0 3 9 14 0 6 8 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 2 8 14 1 0 1 2 13 0 0 4 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 2 2 9 8 1 0 2 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 99 110 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 94 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 160 152 58
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 18 (5.66%)
Threonine (Thr, T)
n = 25 (7.86%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 16 (5.03%)
Leucine (Leu, L)
n = 53 (16.67%)
Isoleucine (Ile, I)
n = 28 (8.81%)
Methionine (Met, M)
n = 20 (6.29%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 21 (6.6%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 18 14 5 10 29 1 8 6 0 2 4 9 1 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 4 14 11 0 0 3 7 2 9 3 10 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 15 0 1 4 11 0 0 2 8 4 2 0 8 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 2 7 0 1 0 7 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 85 95 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 92 57 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 91 153 63
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 49 (14.16%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 23 41 3 7 28 4 7 9 0 3 2 5 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 0 9 7 1 2 6 7 0 4 9 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 2 11 13 0 0 2 3 7 1 0 3 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 1 1 14 1 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 78 152 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 60 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 109 177 52
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.89%)
Leucine (Leu, L)
n = 49 (14.16%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 43 (12.43%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 23 41 3 7 28 4 7 9 0 3 2 5 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 0 9 7 1 2 6 7 0 4 9 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 2 11 13 0 0 2 3 7 1 0 3 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 1 1 14 1 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 78 152 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 60 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 109 177 52
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 91 (19.87%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 9 (1.97%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 19 32 13 10 44 6 18 10 1 3 1 11 3 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 10 11 10 1 4 4 6 4 5 11 6 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 21 0 7 4 17 0 5 6 8 10 1 0 8 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 2 2 1 12 1 1 1 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 125 160 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 120 83 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 118 213 107
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 10 0 3 10 2 5 2 0 0 2 5 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 1 3 0 2 2 0 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 1 3 3 2 0 1 0 3 1 0 1 1 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 21 31 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 18 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 30 42 19
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 38 (6.27%)
Serine (Ser, S)
n = 48 (7.92%)
Threonine (Thr, T)
n = 55 (9.08%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 20 (3.3%)
Leucine (Leu, L)
n = 92 (15.18%)
Isoleucine (Ile, I)
n = 56 (9.24%)
Methionine (Met, M)
n = 38 (6.27%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 42 (6.93%)
Tyrosine (Tyr, Y)
n = 23 (3.8%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 35 37 10 20 41 3 17 16 3 3 4 11 2 22 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 5 20 13 0 1 13 12 3 1 9 15 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 16 1 8 10 17 2 3 8 12 11 1 1 13 22 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 3 2 8 23 1 1 3 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 143 219 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 156 137 248
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 224 244 117
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 3 (1.71%)
Glutamic acid (Glu, E)
n = 10 (5.71%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 2 2 0 0 0 7 0 0 6 0 6 9 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 3 2 4 2 11 2 7 4 3 0 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 2 2 1 2 2 3 2 8 1 3 9 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 7 3 0 2 2 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 7 47 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 34 31 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 10 41 79
Total protein-coding genes (size: 11407 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 217 (5.71%)
Alanine (Ala, A)
n = 245 (6.45%)
Serine (Ser, S)
n = 275 (7.24%)
Threonine (Thr, T)
n = 317 (8.34%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 190 (5.0%)
Leucine (Leu, L)
n = 586 (15.42%)
Isoleucine (Ile, I)
n = 332 (8.74%)
Methionine (Met, M)
n = 259 (6.82%)
Proline (Pro, P)
n = 199 (5.24%)
Phenylalanine (Phe, F)
n = 228 (6.0%)
Tyrosine (Tyr, Y)
n = 142 (3.74%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 99 (2.61%)
Asparagine (Asn, N)
n = 156 (4.11%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 95 (2.5%)
Lysine (Lys, K)
n = 102 (2.68%)
Arginine (Arg, R)
n = 67 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
171 161 215 66 86 267 39 111 82 8 40 37 94 19 111 117
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
44 6 18 57 104 80 4 39 58 97 23 53 67 74 5 71
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
98 136 12 43 57 117 8 18 32 74 68 12 17 65 91 34
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
61 77 22 27 38 93 9 6 11 48 2 1 0 8 0 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
816 909 1217 859
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 986 757 1595
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
224 1104 1592 881

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.