Viewing data for Balaena mysticetus


Scientific name Balaena mysticetus
Common name Bowhead whale
Maximum lifespan 211.00 years (Balaena mysticetus@AnAge)

Total mtDNA (size: 16390 bases) GC AT G C A T
Base content (bases) 6771 9619 4609 2162 4265 5354
Base content per 1 kb (bases) 413 587 281 132 260 327
Base content (%) 41.3% 58.7%
Total protein-coding genes (size: 11349 bases) GC AT G C A T
Base content (bases) 4800 6549 3481 1319 2948 3601
Base content per 1 kb (bases) 423 577 307 116 260 317
Base content (%) 42.3% 57.7%
D-loop (size: 915 bases) GC AT G C A T
Base content (bases) 370 545 216 154 273 272
Base content per 1 kb (bases) 404 596 236 168 298 297
Base content (%) 40.4% 59.6%
Total tRNA-coding genes (size: 1517 bases) GC AT G C A T
Base content (bases) 549 968 321 228 431 537
Base content per 1 kb (bases) 362 638 212 150 284 354
Base content (%) 36.2% 63.8%
Total rRNA-coding genes (size: 2551 bases) GC AT G C A T
Base content (bases) 1030 1521 577 453 600 921
Base content per 1 kb (bases) 404 596 226 178 235 361
Base content (%) 40.4% 59.6%
12S rRNA gene (size: 975 bases) GC AT G C A T
Base content (bases) 419 556 238 181 213 343
Base content per 1 kb (bases) 430 570 244 186 218 352
Base content (%) 43.0% 57.0%
16S rRNA gene (size: 1576 bases) GC AT G C A T
Base content (bases) 611 965 339 272 387 578
Base content per 1 kb (bases) 388 612 215 173 246 367
Base content (%) 38.8% 61.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 274 407 211 63 186 221
Base content per 1 kb (bases) 402 598 310 93 273 325
Base content (%) 40.2% 59.8%
ATP8 (size: 192 bases) GC AT G C A T
Base content (bases) 74 118 63 11 45 73
Base content per 1 kb (bases) 385 615 328 57 234 380
Base content (%) 38.5% 61.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 675 876 431 244 422 454
Base content per 1 kb (bases) 435 565 278 157 272 293
Base content (%) 43.5% 56.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 261 423 174 87 185 238
Base content per 1 kb (bases) 382 618 254 127 270 348
Base content (%) 38.2% 61.8%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 337 449 223 114 231 218
Base content per 1 kb (bases) 429 571 284 145 294 277
Base content (%) 42.9% 57.1%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 505 635 356 149 294 341
Base content per 1 kb (bases) 443 557 312 131 258 299
Base content (%) 44.3% 55.7%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 420 537 302 118 242 295
Base content per 1 kb (bases) 439 561 316 123 253 308
Base content (%) 43.9% 56.1%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 413 631 319 94 261 370
Base content per 1 kb (bases) 396 604 306 90 250 354
Base content (%) 39.6% 60.4%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 151 195 109 42 88 107
Base content per 1 kb (bases) 436 564 315 121 254 309
Base content (%) 43.6% 56.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 595 783 448 147 359 424
Base content per 1 kb (bases) 432 568 325 107 261 308
Base content (%) 43.2% 56.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 126 171 90 36 85 86
Base content per 1 kb (bases) 424 576 303 121 286 290
Base content (%) 42.4% 57.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 789 1032 602 187 462 570
Base content per 1 kb (bases) 433 567 331 103 254 313
Base content (%) 43.3% 56.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 199 329 165 34 105 224
Base content per 1 kb (bases) 377 623 313 64 199 424
Base content (%) 37.7% 62.3%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 28 (12.39%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 41 (18.14%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 14 (6.19%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 13 11 6 6 21 0 8 8 0 2 1 7 0 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 9 4 0 3 2 4 0 4 4 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 10 0 1 4 4 0 0 4 1 1 1 0 4 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 2 0 5 0 0 2 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 65 85 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 66 39 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 80 97 47
ATP8 (size: 192 bases)
Amino acid sequence: MPQLDTSTWLLTILSMLLTLFVLLQLKISKHSHSPNPKLVLTKTRKQQTPWNTTWTKIYLPLS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (9.52%)
Threonine (Thr, T)
n = 10 (15.87%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.17%)
Leucine (Leu, L)
n = 14 (22.22%)
Isoleucine (Ile, I)
n = 3 (4.76%)
Methionine (Met, M)
n = 2 (3.17%)
Proline (Pro, P)
n = 5 (7.94%)
Phenylalanine (Phe, F)
n = 1 (1.59%)
Tyrosine (Tyr, Y)
n = 1 (1.59%)
Tryptophan (Trp, W)
n = 3 (4.76%)
Aspartic acid (Asp, D)
n = 1 (1.59%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.17%)
Glutamine (Gln, Q)
n = 4 (6.35%)
Histidine (His, H)
n = 2 (3.17%)
Lysine (Lys, K)
n = 6 (9.52%)
Arginine (Arg, R)
n = 1 (1.59%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 1 2 3 7 0 1 4 0 0 0 2 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 3 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 1 1 2 3 0 0 0 1 0 0 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 0 1 0 6 0 0 0 1 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 24 23 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 21 17 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 33 9
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.3%)
Alanine (Ala, A)
n = 38 (7.36%)
Serine (Ser, S)
n = 33 (6.4%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 59 (11.43%)
Isoleucine (Ile, I)
n = 36 (6.98%)
Methionine (Met, M)
n = 33 (6.4%)
Proline (Pro, P)
n = 29 (5.62%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 18 (3.49%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 19 (3.68%)
Glutamine (Gln, Q)
n = 6 (1.16%)
Histidine (His, H)
n = 17 (3.29%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 23 27 6 6 30 2 15 5 1 4 13 20 2 7 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 6 16 15 1 7 18 21 2 14 7 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 21 0 6 5 19 0 0 3 7 12 1 0 3 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 1 2 13 9 0 1 2 5 0 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 104 139 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 135 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 192 221 88
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 35 (15.42%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 10 13 3 4 15 1 12 6 0 4 2 6 1 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 1 3 2 1 1 4 3 0 4 4 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 0 3 4 8 0 1 3 5 4 0 0 2 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 12 3 5 6 5 0 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 55 68 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 61 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 64 109 47
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 14 (5.36%)
Serine (Ser, S)
n = 20 (7.66%)
Threonine (Thr, T)
n = 22 (8.43%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 13 (4.98%)
Leucine (Leu, L)
n = 34 (13.03%)
Isoleucine (Ile, I)
n = 18 (6.9%)
Methionine (Met, M)
n = 10 (3.83%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.07%)
Asparagine (Asn, N)
n = 7 (2.68%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 17 (6.51%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 9 7 6 10 3 5 7 0 0 5 7 1 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 5 5 4 0 3 8 9 0 4 4 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 3 4 9 0 2 2 7 4 1 3 5 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 0 0 3 2 1 2 0 3 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 67 64 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 64 57 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 92 97 60
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 37 (9.76%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 28 14 5 11 33 3 7 7 0 1 8 5 3 6 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 10 15 0 4 13 6 1 2 10 10 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 0 2 7 8 0 2 2 6 9 0 0 7 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 4 8 10 0 1 1 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 103 109 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 93 78 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 160 154 55
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 30 (9.43%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 28 (8.81%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.46%)
Leucine (Leu, L)
n = 56 (17.61%)
Isoleucine (Ile, I)
n = 25 (7.86%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 21 (6.6%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 4 (1.26%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 11 (3.46%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 17 13 4 10 29 6 7 7 0 0 1 10 0 3 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 3 14 13 0 2 4 4 2 5 10 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 17 0 1 11 5 0 0 4 6 5 2 0 3 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 3 1 7 0 0 1 7 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 90 94 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 97 56 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 115 145 43
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 19 (5.48%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.03%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 22 32 7 11 33 2 9 12 0 0 3 4 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 11 6 1 1 6 6 1 5 6 9 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 24 1 3 9 9 1 1 2 0 9 1 1 7 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 1 0 0 8 4 0 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 93 144 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 108 58 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 118 168 44
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 19 (5.48%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 46 (13.26%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 34 (9.8%)
Methionine (Met, M)
n = 35 (10.09%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 14 (4.03%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 4 (1.15%)
Lysine (Lys, K)
n = 12 (3.46%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 22 32 7 11 33 2 9 12 0 0 3 4 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 11 6 1 1 6 6 1 5 6 9 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 24 1 3 9 9 1 1 2 0 9 1 1 7 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 1 0 0 8 4 0 1 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 93 144 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 108 58 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 118 168 44
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 31 (6.77%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 18 (3.93%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 28 23 16 18 51 3 9 11 0 3 3 5 2 3 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 1 7 12 11 0 2 6 8 1 1 14 9 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 19 1 4 17 7 0 4 6 4 11 1 1 6 16 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 1 1 2 8 3 1 3 5 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 147 153 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 120 85 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 181 186 70
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 5 7 3 5 10 0 4 2 0 0 2 2 2 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 5 4 0 1 2 1 0 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 0 5 1 0 0 1 1 2 0 0 1 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 25 30 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 18 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 41 38 16
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 41 (6.77%)
Serine (Ser, S)
n = 43 (7.1%)
Threonine (Thr, T)
n = 62 (10.23%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 13 (2.15%)
Leucine (Leu, L)
n = 102 (16.83%)
Isoleucine (Ile, I)
n = 55 (9.08%)
Methionine (Met, M)
n = 32 (5.28%)
Proline (Pro, P)
n = 30 (4.95%)
Phenylalanine (Phe, F)
n = 45 (7.43%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 13 (2.15%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 33 (5.45%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 43 30 15 27 36 6 17 19 1 3 4 6 0 10 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 2 6 21 14 0 2 8 13 4 2 18 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 25 0 2 20 9 2 2 8 6 11 1 1 9 24 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 1 1 10 20 3 2 4 2 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 157 215 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 166 131 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 279 224 83
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.0%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 7 (4.0%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 32 (18.29%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 12 (6.86%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 8 (4.57%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 2 (1.14%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 0 4 0 0 1 1 11 0 1 20 0 8 4 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 4 0 2 2 13 0 5 10 3 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 3 1 1 2 5 0 7 1 3 5 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 2 0 0 4 0 0 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 7 39 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 25 28 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 2 38 90
Total protein-coding genes (size: 11405 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.63%)
Alanine (Ala, A)
n = 251 (6.61%)
Serine (Ser, S)
n = 263 (6.92%)
Threonine (Thr, T)
n = 342 (9.0%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 179 (4.71%)
Leucine (Leu, L)
n = 629 (16.55%)
Isoleucine (Ile, I)
n = 314 (8.26%)
Methionine (Met, M)
n = 228 (6.0%)
Proline (Pro, P)
n = 203 (5.34%)
Phenylalanine (Phe, F)
n = 238 (6.26%)
Tyrosine (Tyr, Y)
n = 123 (3.24%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 156 (4.11%)
Glutamine (Gln, Q)
n = 94 (2.47%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 97 (2.55%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
105 209 189 75 114 290 28 110 91 3 37 42 85 15 65 173
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
39 13 10 38 115 93 5 39 72 82 21 48 84 68 3 39
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
128 170 5 29 91 84 5 17 37 52 71 11 12 52 104 26
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 78 19 22 45 82 15 7 16 39 2 2 0 6 3 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
808 970 1193 830
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 1005 745 1588
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
186 1387 1564 664

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.