Viewing data for Heteronotia binoei


Scientific name Heteronotia binoei
Common name Prickly gecko
Maximum lifespan 13.60 years (Heteronotia binoei@AnAge)

Total mtDNA (size: 25972 bases) GC AT G C A T
Base content (bases) 11368 14604 8009 3359 5961 8643
Base content per 1 kb (bases) 438 562 308 129 230 333
Base content (%) 43.8% 56.2%
Total protein-coding genes (size: 15342 bases) GC AT G C A T
Base content (bases) 6883 8459 5108 1775 3597 4862
Base content per 1 kb (bases) 449 551 333 116 234 317
Base content (%) 44.9% 55.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 2121 bases) GC AT G C A T
Base content (bases) 944 1177 581 363 507 670
Base content per 1 kb (bases) 445 555 274 171 239 316
Base content (%) 44.5% 55.5%
Total rRNA-coding genes (size: 5004 bases) GC AT G C A T
Base content (bases) 2307 2697 1454 853 950 1747
Base content per 1 kb (bases) 461 539 291 170 190 349
Base content (%) 46.1% 53.9%
12S rRNA gene (size: 950 bases) GC AT G C A T
Base content (bases) 457 493 290 167 176 317
Base content per 1 kb (bases) 481 519 305 176 185 334
Base content (%) 48.1% 51.9%
16S rRNA gene (size: 1552 bases) GC AT G C A T
Base content (bases) 696 856 437 259 299 557
Base content per 1 kb (bases) 448 552 282 167 193 359
Base content (%) 44.8% 55.2%

ATP6 (size: 680 bases) GC AT G C A T
Base content (bases) 309 371 239 70 164 207
Base content per 1 kb (bases) 454 546 351 103 241 304
Base content (%) 45.4% 54.6%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 69 96 53 16 37 59
Base content per 1 kb (bases) 418 582 321 97 224 358
Base content (%) 41.8% 58.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 707 844 439 268 429 415
Base content per 1 kb (bases) 456 544 283 173 277 268
Base content (%) 45.6% 54.4%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 313 375 210 103 156 219
Base content per 1 kb (bases) 455 545 305 150 227 318
Base content (%) 45.5% 54.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 358 426 241 117 201 225
Base content per 1 kb (bases) 457 543 307 149 256 287
Base content (%) 45.7% 54.3%
CYTB (size: 1139 bases) GC AT G C A T
Base content (bases) 515 624 374 141 293 331
Base content per 1 kb (bases) 452 548 328 124 257 291
Base content (%) 45.2% 54.8%
ND1 (size: 969 bases) GC AT G C A T
Base content (bases) 419 550 312 107 241 309
Base content per 1 kb (bases) 432 568 322 110 249 319
Base content (%) 43.2% 56.8%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 467 574 377 90 213 361
Base content per 1 kb (bases) 449 551 362 86 205 347
Base content (%) 44.9% 55.1%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 155 192 112 43 97 95
Base content per 1 kb (bases) 447 553 323 124 280 274
Base content (%) 44.7% 55.3%
ND4 (size: 1359 bases) GC AT G C A T
Base content (bases) 594 765 457 137 326 439
Base content per 1 kb (bases) 437 563 336 101 240 323
Base content (%) 43.7% 56.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 135 162 99 36 75 87
Base content per 1 kb (bases) 455 545 333 121 253 293
Base content (%) 45.5% 54.5%
ND5 (size: 1784 bases) GC AT G C A T
Base content (bases) 780 1004 601 179 417 587
Base content per 1 kb (bases) 437 563 337 100 234 329
Base content (%) 43.7% 56.3%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 256 266 214 42 52 214
Base content per 1 kb (bases) 490 510 410 80 100 410
Base content (%) 49.0% 51.0%

ATP6 (size: 680 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.56%)
Alanine (Ala, A)
n = 14 (6.22%)
Serine (Ser, S)
n = 9 (4.0%)
Threonine (Thr, T)
n = 33 (14.67%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.56%)
Leucine (Leu, L)
n = 64 (28.44%)
Isoleucine (Ile, I)
n = 15 (6.67%)
Methionine (Met, M)
n = 14 (6.22%)
Proline (Pro, P)
n = 18 (8.0%)
Phenylalanine (Phe, F)
n = 6 (2.67%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 2 (0.89%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 7 (3.11%)
Glutamine (Gln, Q)
n = 10 (4.44%)
Histidine (His, H)
n = 4 (1.78%)
Lysine (Lys, K)
n = 2 (0.89%)
Arginine (Arg, R)
n = 5 (2.22%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 12 10 11 29 7 6 9 1 0 1 5 2 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 6 4 1 0 4 3 1 1 8 9 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 1 1 2 2 0 2 2 2 1 1 1 1 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 2 0 0 5 0 0 0 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
34 94 75 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 70 30 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 75 101 33
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPAPWFFTFMLVWSILLLLLKPTLMELKSTHQPQPHTMKHTLTPWAWTWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.7%)
Serine (Ser, S)
n = 2 (3.7%)
Threonine (Thr, T)
n = 7 (12.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.85%)
Leucine (Leu, L)
n = 10 (18.52%)
Isoleucine (Ile, I)
n = 1 (1.85%)
Methionine (Met, M)
n = 4 (7.41%)
Proline (Pro, P)
n = 7 (12.96%)
Phenylalanine (Phe, F)
n = 3 (5.56%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.85%)
Asparagine (Asn, N)
n = 1 (1.85%)
Glutamine (Gln, Q)
n = 3 (5.56%)
Histidine (His, H)
n = 4 (7.41%)
Lysine (Lys, K)
n = 3 (5.56%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 1 3 1 0 6 0 3 1 2 0 1 0 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 1 0 0 0 0 0 1 1 4 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 0 1 0 0 1 0 0 1 0 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 0 0 3 0 0 0 0 0 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 21 17 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 17 13 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 15 29 5
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.3%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 29 (5.62%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 36 (6.98%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 34 (6.59%)
Methionine (Met, M)
n = 30 (5.81%)
Proline (Pro, P)
n = 32 (6.2%)
Phenylalanine (Phe, F)
n = 39 (7.56%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 16 (3.1%)
Glutamine (Gln, Q)
n = 5 (0.97%)
Histidine (His, H)
n = 21 (4.07%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 17 25 13 10 20 4 12 3 2 6 7 21 2 19 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 11 18 13 5 7 19 17 5 5 11 14 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 13 0 3 6 15 0 1 4 10 9 1 3 4 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 7 2 4 10 8 1 1 3 3 1 1 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 113 134 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 142 93 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 184 188 112
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 18 (7.89%)
Serine (Ser, S)
n = 13 (5.7%)
Threonine (Thr, T)
n = 24 (10.53%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 16 (7.02%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 14 (6.14%)
Methionine (Met, M)
n = 13 (5.7%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 12 (5.26%)
Glutamic acid (Glu, E)
n = 11 (4.82%)
Asparagine (Asn, N)
n = 7 (3.07%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 11 (4.82%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 9 11 2 6 12 4 5 9 0 5 3 6 2 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 9 7 0 0 6 2 1 1 3 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 2 1 3 6 0 1 2 2 6 0 1 2 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 1 2 10 2 0 0 4 1 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 61 63 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 64 60 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 85 96 35
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 33 (12.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 8 10 7 6 16 1 2 7 1 3 2 8 0 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 9 9 2 2 11 3 2 1 3 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 2 3 3 0 1 4 3 8 2 0 1 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 1 2 3 2 0 1 3 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 69 69 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 73 55 92
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 99 101 51
CYTB (size: 1139 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.82%)
Alanine (Ala, A)
n = 25 (6.61%)
Serine (Ser, S)
n = 23 (6.08%)
Threonine (Thr, T)
n = 34 (8.99%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 13 (3.44%)
Leucine (Leu, L)
n = 61 (16.14%)
Isoleucine (Ile, I)
n = 32 (8.47%)
Methionine (Met, M)
n = 19 (5.03%)
Proline (Pro, P)
n = 25 (6.61%)
Phenylalanine (Phe, F)
n = 28 (7.41%)
Tyrosine (Tyr, Y)
n = 15 (3.97%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 8 (2.12%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 19 (5.03%)
Glutamine (Gln, Q)
n = 6 (1.59%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 8 (2.12%)
Arginine (Arg, R)
n = 8 (2.12%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 20 17 9 12 23 8 9 6 0 2 6 5 0 8 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 0 14 11 0 1 11 7 3 2 6 17 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 9 1 4 8 7 1 0 3 6 9 2 0 3 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 1 0 8 8 0 0 2 5 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 103 115 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 104 75 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 167 140 53
ND1 (size: 969 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.66%)
Alanine (Ala, A)
n = 25 (7.76%)
Serine (Ser, S)
n = 19 (5.9%)
Threonine (Thr, T)
n = 31 (9.63%)
Cysteine (Cys, C)
n = 3 (0.93%)
Valine (Val, V)
n = 7 (2.17%)
Leucine (Leu, L)
n = 70 (21.74%)
Isoleucine (Ile, I)
n = 21 (6.52%)
Methionine (Met, M)
n = 20 (6.21%)
Proline (Pro, P)
n = 25 (7.76%)
Phenylalanine (Phe, F)
n = 14 (4.35%)
Tyrosine (Tyr, Y)
n = 11 (3.42%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 10 (3.11%)
Asparagine (Asn, N)
n = 12 (3.73%)
Glutamine (Gln, Q)
n = 8 (2.48%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 9 17 7 12 45 3 3 8 0 2 1 4 0 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 2 13 10 0 2 5 6 2 5 5 14 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 12 0 3 7 8 0 0 1 3 8 1 0 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 9 1 0 4 8 0 1 0 7 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 111 93 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 99 57 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 102 159 51
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.89%)
Alanine (Ala, A)
n = 27 (7.8%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 63 (18.21%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 70 (20.23%)
Isoleucine (Ile, I)
n = 26 (7.51%)
Methionine (Met, M)
n = 24 (6.94%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 7 (2.02%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 7 (2.02%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 22 21 7 13 44 0 6 7 0 1 0 2 0 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 1 18 8 0 1 6 3 0 3 9 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 32 0 1 9 10 0 1 10 1 7 0 0 1 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 2 10 0 0 2 3 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 103 143 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 130 49 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 144 169 29
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.89%)
Alanine (Ala, A)
n = 27 (7.8%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 63 (18.21%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 3 (0.87%)
Leucine (Leu, L)
n = 70 (20.23%)
Isoleucine (Ile, I)
n = 26 (7.51%)
Methionine (Met, M)
n = 24 (6.94%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 7 (2.02%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 9 (2.6%)
Glutamine (Gln, Q)
n = 7 (2.02%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 22 21 7 13 44 0 6 7 0 1 0 2 0 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 1 18 8 0 1 6 3 0 3 9 8 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 32 0 1 9 10 0 1 10 1 7 0 0 1 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 1 0 2 10 0 0 2 3 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 103 143 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 130 49 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 144 169 29
ND4 (size: 1359 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.54%)
Alanine (Ala, A)
n = 34 (7.52%)
Serine (Ser, S)
n = 23 (5.09%)
Threonine (Thr, T)
n = 62 (13.72%)
Cysteine (Cys, C)
n = 5 (1.11%)
Valine (Val, V)
n = 10 (2.21%)
Leucine (Leu, L)
n = 95 (21.02%)
Isoleucine (Ile, I)
n = 39 (8.63%)
Methionine (Met, M)
n = 33 (7.3%)
Proline (Pro, P)
n = 24 (5.31%)
Phenylalanine (Phe, F)
n = 15 (3.32%)
Tyrosine (Tyr, Y)
n = 12 (2.65%)
Tryptophan (Trp, W)
n = 11 (2.43%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 7 (1.55%)
Asparagine (Asn, N)
n = 16 (3.54%)
Glutamine (Gln, Q)
n = 12 (2.65%)
Histidine (His, H)
n = 15 (3.32%)
Lysine (Lys, K)
n = 10 (2.21%)
Arginine (Arg, R)
n = 10 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 24 30 8 22 46 7 11 12 0 2 3 5 0 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 4 3 21 9 1 0 7 7 2 2 7 15 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 28 1 2 9 8 0 1 3 3 9 3 1 7 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 5 2 0 3 10 0 2 3 5 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 144 164 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 139 76 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 174 199 59
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 17 (17.35%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 1 (1.02%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 3 (3.06%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 4 3 4 2 5 1 6 2 0 0 1 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 2 7 2 1 0 2 1 1 1 0 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 1 4 1 0 0 1 0 0 0 1 0 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 1 3 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 23 34 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
11 37 15 36
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 39 38 17
ND5 (size: 1784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (3.88%)
Alanine (Ala, A)
n = 46 (7.76%)
Serine (Ser, S)
n = 44 (7.42%)
Threonine (Thr, T)
n = 79 (13.32%)
Cysteine (Cys, C)
n = 8 (1.35%)
Valine (Val, V)
n = 13 (2.19%)
Leucine (Leu, L)
n = 109 (18.38%)
Isoleucine (Ile, I)
n = 45 (7.59%)
Methionine (Met, M)
n = 33 (5.56%)
Proline (Pro, P)
n = 25 (4.22%)
Phenylalanine (Phe, F)
n = 27 (4.55%)
Tyrosine (Tyr, Y)
n = 15 (2.53%)
Tryptophan (Trp, W)
n = 10 (1.69%)
Aspartic acid (Asp, D)
n = 10 (1.69%)
Glutamic acid (Glu, E)
n = 8 (1.35%)
Asparagine (Asn, N)
n = 32 (5.4%)
Glutamine (Gln, Q)
n = 24 (4.05%)
Histidine (His, H)
n = 17 (2.87%)
Lysine (Lys, K)
n = 17 (2.87%)
Arginine (Arg, R)
n = 9 (1.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 29 31 14 21 56 6 10 21 3 4 3 5 1 11 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 5 3 23 19 1 0 14 9 0 2 6 15 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
38 32 0 3 17 16 0 1 7 4 11 2 2 5 27 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 1 3 7 16 1 0 5 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 172 214 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 186 123 227
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 243 249 81
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 37 (21.39%)
Alanine (Ala, A)
n = 10 (5.78%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 0 (0%)
Cysteine (Cys, C)
n = 5 (2.89%)
Valine (Val, V)
n = 30 (17.34%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 0 (0%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 1 4 0 1 4 3 0 0 17 0 6 7 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 5 0 3 1 1 5 8 1 7 21 2 0 1 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 1 1 0 5 0 7 0 5 16 0 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 4 3 0 0 0 1 0 0 3 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 18 14 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 21 16 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
73 3 22 76
Total protein-coding genes (size: 15374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 286 (5.59%)
Alanine (Ala, A)
n = 372 (7.27%)
Serine (Ser, S)
n = 344 (6.72%)
Threonine (Thr, T)
n = 549 (10.72%)
Cysteine (Cys, C)
n = 49 (0.96%)
Valine (Val, V)
n = 208 (4.06%)
Leucine (Leu, L)
n = 859 (16.78%)
Isoleucine (Ile, I)
n = 317 (6.19%)
Methionine (Met, M)
n = 259 (5.06%)
Proline (Pro, P)
n = 342 (6.68%)
Phenylalanine (Phe, F)
n = 265 (5.18%)
Tyrosine (Tyr, Y)
n = 184 (3.59%)
Tryptophan (Trp, W)
n = 126 (2.46%)
Aspartic acid (Asp, D)
n = 90 (1.76%)
Glutamic acid (Glu, E)
n = 108 (2.11%)
Asparagine (Asn, N)
n = 175 (3.42%)
Glutamine (Gln, Q)
n = 165 (3.22%)
Histidine (His, H)
n = 152 (2.97%)
Lysine (Lys, K)
n = 115 (2.25%)
Arginine (Arg, R)
n = 90 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
127 190 216 110 146 379 66 106 145 20 65 37 83 23 111 154
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
43 22 27 44 183 122 23 34 100 86 66 59 90 173 20 73
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
238 224 14 53 101 116 11 18 45 66 118 27 52 40 135 39
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
113 84 24 20 70 105 10 9 31 41 9 2 1 29 33 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1064 1450 1481 1125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
617 1544 1051 1908
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
442 1778 2010 890

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.