Viewing data for Carcharodon carcharias


Scientific name Carcharodon carcharias
Common name Great white shark
Maximum lifespan 50.00 years (Carcharodon carcharias@AnAge)

Total mtDNA (size: 16744 bases) GC AT G C A T
Base content (bases) 6824 9920 4498 2326 4801 5119
Base content per 1 kb (bases) 408 592 269 139 287 306
Base content (%) 40.8% 59.2%
Total protein-coding genes (size: 11406 bases) GC AT G C A T
Base content (bases) 4758 6648 3320 1438 3331 3317
Base content per 1 kb (bases) 417 583 291 126 292 291
Base content (%) 41.7% 58.3%
D-loop (size: 1115 bases) GC AT G C A T
Base content (bases) 390 725 246 144 362 363
Base content per 1 kb (bases) 350 650 221 129 325 326
Base content (%) 35.0% 65.0%
Total tRNA-coding genes (size: 1549 bases) GC AT G C A T
Base content (bases) 616 933 346 270 426 507
Base content per 1 kb (bases) 398 602 223 174 275 327
Base content (%) 39.8% 60.2%
Total rRNA-coding genes (size: 2627 bases) GC AT G C A T
Base content (bases) 1040 1587 575 465 669 918
Base content per 1 kb (bases) 396 604 219 177 255 349
Base content (%) 39.6% 60.4%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 404 552 225 179 230 322
Base content per 1 kb (bases) 423 577 235 187 241 337
Base content (%) 42.3% 57.7%
16S rRNA gene (size: 1671 bases) GC AT G C A T
Base content (bases) 636 1035 350 286 439 596
Base content per 1 kb (bases) 381 619 209 171 263 357
Base content (%) 38.1% 61.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 273 411 202 71 207 204
Base content per 1 kb (bases) 399 601 295 104 303 298
Base content (%) 39.9% 60.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 59 109 44 15 44 65
Base content per 1 kb (bases) 351 649 262 89 262 387
Base content (%) 35.1% 64.9%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 670 884 402 268 479 405
Base content per 1 kb (bases) 431 569 259 172 308 261
Base content (%) 43.1% 56.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 279 412 173 106 202 210
Base content per 1 kb (bases) 404 596 250 153 292 304
Base content (%) 40.4% 59.6%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 339 447 214 125 227 220
Base content per 1 kb (bases) 431 569 272 159 289 280
Base content (%) 43.1% 56.9%
CYTB (size: 1146 bases) GC AT G C A T
Base content (bases) 498 648 352 146 344 304
Base content per 1 kb (bases) 435 565 307 127 300 265
Base content (%) 43.5% 56.5%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 409 566 289 120 292 274
Base content per 1 kb (bases) 419 581 296 123 299 281
Base content (%) 41.9% 58.1%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 436 608 331 105 306 302
Base content per 1 kb (bases) 418 582 317 101 293 289
Base content (%) 41.8% 58.2%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 150 201 102 48 112 89
Base content per 1 kb (bases) 427 573 291 137 319 254
Base content (%) 42.7% 57.3%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 571 810 407 164 401 409
Base content per 1 kb (bases) 413 587 295 119 290 296
Base content (%) 41.3% 58.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 114 183 81 33 105 78
Base content per 1 kb (bases) 384 616 273 111 354 263
Base content (%) 38.4% 61.6%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 751 1079 557 194 528 551
Base content per 1 kb (bases) 410 590 304 106 289 301
Base content (%) 41.0% 59.0%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 216 306 171 45 90 216
Base content per 1 kb (bases) 414 586 328 86 172 414
Base content (%) 41.4% 58.6%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 8 (3.52%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 50 (22.03%)
Isoleucine (Ile, I)
n = 24 (10.57%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 17 (7.49%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 12 8 9 10 21 1 9 9 0 0 2 5 3 12 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 6 7 0 3 2 3 0 2 5 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 1 0 2 2 0 2 2 3 1 0 0 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 2 1 0 1 0 0 0 5 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 73 76 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 61 34 112
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 68 94 56
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPHPWLMILLFSWTIFLIILPKKVTNHLYSNNPALKSTEKSKPEPWNWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 0 1 1 1 0 4 1 0 0 0 1 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 1 0 0 0 0 0 3 2 3 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 1 1 1 0 1 1 1 0 0 1 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 0 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 14 21 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 15 17 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 15 27 10
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.9%)
Alanine (Ala, A)
n = 46 (8.9%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 34 (6.58%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.35%)
Leucine (Leu, L)
n = 65 (12.57%)
Isoleucine (Ile, I)
n = 44 (8.51%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 29 (5.61%)
Phenylalanine (Phe, F)
n = 38 (7.35%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 16 (3.09%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 19 16 15 14 15 5 15 8 1 14 6 12 6 20 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 9 17 19 1 19 7 14 6 6 11 11 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 2 7 9 10 0 0 3 8 11 2 1 9 7 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 2 6 8 8 0 2 0 6 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
155 115 130 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 97 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 152 178 151
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 11 (4.8%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 21 (9.17%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 8 11 4 4 6 1 11 9 0 6 6 5 1 7 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 5 7 4 1 2 4 1 2 3 5 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 0 4 4 5 0 1 2 5 5 1 0 2 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 15 1 5 7 4 0 3 0 3 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 53 56 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 66 89 66
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 20 (7.66%)
Serine (Ser, S)
n = 13 (4.98%)
Threonine (Thr, T)
n = 24 (9.2%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.75%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 16 (6.13%)
Methionine (Met, M)
n = 9 (3.45%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 6 8 9 5 12 1 6 8 0 5 2 6 2 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 4 11 5 0 3 4 12 2 3 4 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 14 0 1 2 5 1 0 4 9 3 2 0 1 1 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 1 1 4 2 1 0 2 3 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 69 58 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 79 106 66
CYTB (size: 1146 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.82%)
Alanine (Ala, A)
n = 26 (6.82%)
Serine (Ser, S)
n = 22 (5.77%)
Threonine (Thr, T)
n = 19 (4.99%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 18 (4.72%)
Leucine (Leu, L)
n = 63 (16.54%)
Isoleucine (Ile, I)
n = 42 (11.02%)
Methionine (Met, M)
n = 11 (2.89%)
Proline (Pro, P)
n = 20 (5.25%)
Phenylalanine (Phe, F)
n = 32 (8.4%)
Tyrosine (Tyr, Y)
n = 14 (3.67%)
Tryptophan (Trp, W)
n = 13 (3.41%)
Aspartic acid (Asp, D)
n = 9 (2.36%)
Glutamic acid (Glu, E)
n = 6 (1.57%)
Asparagine (Asn, N)
n = 20 (5.25%)
Glutamine (Gln, Q)
n = 9 (2.36%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 9 (2.36%)
Arginine (Arg, R)
n = 8 (2.1%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 22 9 12 20 17 4 10 9 0 3 10 5 0 11 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 15 9 0 3 11 11 1 4 9 7 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 0 4 10 5 0 1 2 5 9 0 0 4 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 1 3 6 9 0 3 1 4 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 101 104 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 84 79 166
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 167 121 86
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 24 (7.41%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 27 (8.33%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.32%)
Leucine (Leu, L)
n = 68 (20.99%)
Isoleucine (Ile, I)
n = 25 (7.72%)
Methionine (Met, M)
n = 14 (4.32%)
Proline (Pro, P)
n = 22 (6.79%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 15 (4.63%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.7%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 7 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 13 12 13 13 21 4 16 4 1 3 5 5 1 11 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 10 11 0 1 9 7 1 3 13 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 9 0 2 8 10 0 2 1 11 4 1 1 5 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 2 1 2 7 0 1 2 4 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 88 87 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 93 57 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 108 130 74
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 26 (7.49%)
Serine (Ser, S)
n = 36 (10.37%)
Threonine (Thr, T)
n = 35 (10.09%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 74 (21.33%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 16 (4.61%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 14 13 16 17 21 3 17 9 1 1 4 2 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 5 16 5 0 1 10 5 1 3 10 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 1 6 13 12 0 1 4 6 2 0 0 7 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 0 9 1 1 1 2 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 97 114 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 111 57 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 123 131 83
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 26 (7.49%)
Serine (Ser, S)
n = 36 (10.37%)
Threonine (Thr, T)
n = 35 (10.09%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 74 (21.33%)
Isoleucine (Ile, I)
n = 33 (9.51%)
Methionine (Met, M)
n = 16 (4.61%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 14 13 16 17 21 3 17 9 1 1 4 2 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 5 16 5 0 1 10 5 1 3 10 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 1 6 13 12 0 1 4 6 2 0 0 7 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 0 9 1 1 1 2 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 97 114 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 111 57 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 123 131 83
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.58%)
Alanine (Ala, A)
n = 33 (7.19%)
Serine (Ser, S)
n = 33 (7.19%)
Threonine (Thr, T)
n = 36 (7.84%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 87 (18.95%)
Isoleucine (Ile, I)
n = 47 (10.24%)
Methionine (Met, M)
n = 32 (6.97%)
Proline (Pro, P)
n = 25 (5.45%)
Phenylalanine (Phe, F)
n = 21 (4.58%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 16 27 20 20 28 5 13 11 1 1 4 5 1 12 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 3 8 17 8 0 2 8 11 0 2 13 10 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 0 5 12 6 1 1 8 5 8 1 1 7 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 3 1 4 11 0 0 2 9 0 0 0 0 0 19
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 132 151 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 118 79 198
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 157 179 106
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 5 7 3 7 0 5 2 0 1 0 0 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 4 1 4 0 2 2 0 0 2 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 4 2 4 1 1 2 2 0 0 1 1 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 0 0 0 2 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 25 29 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 30 16 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 26 33 37
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.6%)
Alanine (Ala, A)
n = 42 (6.9%)
Serine (Ser, S)
n = 52 (8.54%)
Threonine (Thr, T)
n = 49 (8.05%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 16 (2.63%)
Leucine (Leu, L)
n = 106 (17.41%)
Isoleucine (Ile, I)
n = 62 (10.18%)
Methionine (Met, M)
n = 27 (4.43%)
Proline (Pro, P)
n = 29 (4.76%)
Phenylalanine (Phe, F)
n = 40 (6.57%)
Tyrosine (Tyr, Y)
n = 14 (2.3%)
Tryptophan (Trp, W)
n = 13 (2.13%)
Aspartic acid (Asp, D)
n = 12 (1.97%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 35 (5.75%)
Glutamine (Gln, Q)
n = 22 (3.61%)
Histidine (His, H)
n = 15 (2.46%)
Lysine (Lys, K)
n = 22 (3.61%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 28 23 19 27 36 5 18 21 1 7 2 5 2 15 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 7 26 9 0 5 9 14 0 8 10 11 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 0 6 23 11 1 3 8 5 9 2 1 12 23 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 2 6 6 22 0 0 6 2 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 162 206 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 161 132 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 234 213 144
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.72%)
Alanine (Ala, A)
n = 12 (6.94%)
Serine (Ser, S)
n = 9 (5.2%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 23 (13.29%)
Leucine (Leu, L)
n = 34 (19.65%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 12 (6.94%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 12 (6.94%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 7 (4.05%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 9 (5.2%)
Asparagine (Asn, N)
n = 4 (2.31%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 3 2 0 2 1 13 0 0 8 0 6 9 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 0 8 0 2 2 7 0 3 12 3 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 2 1 4 0 1 1 10 0 4 16 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 9 3 0 0 0 2 0 0 1 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 13 25 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 28 27 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 4 38 67
Total protein-coding genes (size: 11429 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 226 (5.93%)
Alanine (Ala, A)
n = 281 (7.38%)
Serine (Ser, S)
n = 267 (7.01%)
Threonine (Thr, T)
n = 281 (7.38%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 176 (4.62%)
Leucine (Leu, L)
n = 667 (17.52%)
Isoleucine (Ile, I)
n = 334 (8.77%)
Methionine (Met, M)
n = 181 (4.75%)
Proline (Pro, P)
n = 207 (5.44%)
Phenylalanine (Phe, F)
n = 236 (6.2%)
Tyrosine (Tyr, Y)
n = 124 (3.26%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 105 (2.76%)
Asparagine (Asn, N)
n = 150 (3.94%)
Glutamine (Gln, Q)
n = 98 (2.57%)
Histidine (His, H)
n = 101 (2.65%)
Lysine (Lys, K)
n = 81 (2.13%)
Arginine (Arg, R)
n = 71 (1.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
188 146 137 132 143 194 33 143 93 5 49 42 59 26 122 114
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
44 9 15 61 128 88 4 48 68 85 25 44 83 78 2 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
100 118 6 45 90 76 4 14 38 72 52 13 22 58 92 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 80 25 28 40 79 2 13 17 38 3 0 1 9 1 107
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
856 979 1080 894
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
494 984 737 1594
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
216 1236 1384 973

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.