Viewing data for Apus apus


Scientific name Apus apus
Common name Swift
Maximum lifespan 21.10 years (Apus apus@AnAge)

Total mtDNA (size: 17037 bases) GC AT G C A T
Base content (bases) 7618 9419 5370 2248 4075 5344
Base content per 1 kb (bases) 447 553 315 132 239 314
Base content (%) 44.7% 55.3%
Total protein-coding genes (size: 11368 bases) GC AT G C A T
Base content (bases) 5208 6160 3872 1336 2716 3444
Base content per 1 kb (bases) 458 542 341 118 239 303
Base content (%) 45.8% 54.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1546 bases) GC AT G C A T
Base content (bases) 663 883 396 267 388 495
Base content per 1 kb (bases) 429 571 256 173 251 320
Base content (%) 42.9% 57.1%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1172 1400 697 475 528 872
Base content per 1 kb (bases) 456 544 271 185 205 339
Base content (%) 45.6% 54.4%
12S rRNA gene (size: 970 bases) GC AT G C A T
Base content (bases) 456 514 272 184 199 315
Base content per 1 kb (bases) 470 530 280 190 205 325
Base content (%) 47.0% 53.0%
16S rRNA gene (size: 1602 bases) GC AT G C A T
Base content (bases) 716 886 425 291 329 557
Base content per 1 kb (bases) 447 553 265 182 205 348
Base content (%) 44.7% 55.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 315 369 249 66 167 202
Base content per 1 kb (bases) 461 539 364 96 244 295
Base content (%) 46.1% 53.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 75 93 68 7 36 57
Base content per 1 kb (bases) 446 554 405 42 214 339
Base content (%) 44.6% 55.4%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 739 812 496 243 384 428
Base content per 1 kb (bases) 476 524 320 157 248 276
Base content (%) 47.6% 52.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 215 96 159 214
Base content per 1 kb (bases) 455 545 314 140 232 313
Base content (%) 45.5% 54.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 363 421 248 115 196 225
Base content per 1 kb (bases) 463 537 316 147 250 287
Base content (%) 46.3% 53.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 531 612 395 136 287 325
Base content per 1 kb (bases) 465 535 346 119 251 284
Base content (%) 46.5% 53.5%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 440 538 319 121 261 277
Base content per 1 kb (bases) 450 550 326 124 267 283
Base content (%) 45.0% 55.0%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 457 584 359 98 250 334
Base content per 1 kb (bases) 439 561 345 94 240 321
Base content (%) 43.9% 56.1%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 157 194 117 40 98 96
Base content per 1 kb (bases) 447 553 333 114 279 274
Base content (%) 44.7% 55.3%
ND4 (size: 1368 bases) GC AT G C A T
Base content (bases) 623 745 484 139 326 419
Base content per 1 kb (bases) 455 545 354 102 238 306
Base content (%) 45.5% 54.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 131 166 98 33 75 91
Base content per 1 kb (bases) 441 559 330 111 253 306
Base content (%) 44.1% 55.9%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 823 992 630 193 420 572
Base content per 1 kb (bases) 453 547 347 106 231 315
Base content (%) 45.3% 54.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 248 274 197 51 61 213
Base content per 1 kb (bases) 475 525 377 98 117 408
Base content (%) 47.5% 52.5%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (2.2%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 3 (1.32%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 8 7 22 24 1 7 8 0 0 3 2 0 0 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 9 4 0 0 4 3 2 2 3 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 4 3 4 0 0 4 0 3 0 0 1 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 2 1 3 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 87 71 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 68 35 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 94 96 31
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMLLSWLTFTLIIQPKLLSFPPTNPPSNKTTAHTKTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 1 1 2 4 0 0 2 0 0 0 0 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 3 4 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 2 0 0 0 3 0 0 0 0 0 0 0 0 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 20 22 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 24 11 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 24 24 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 48 (9.3%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 32 (6.2%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 44 (8.53%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 41 (7.95%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 32 19 7 14 35 0 7 9 1 3 12 16 1 9 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 8 21 18 1 6 16 23 2 9 10 10 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 12 0 1 13 9 1 0 3 3 16 0 0 0 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 9 1 3 12 9 0 1 2 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 123 133 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 97 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 234 198 71
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 17 9 6 6 13 1 5 7 0 2 6 6 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 6 5 2 2 1 5 1 1 5 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 1 7 9 0 0 3 0 8 1 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 1 3 9 4 0 1 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 61 56 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 60 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 94 98 29
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 14 7 2 6 20 1 3 8 0 4 6 4 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 9 10 0 0 5 11 4 4 3 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 0 2 6 7 0 0 4 5 5 0 0 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 0 1 3 3 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 72 59 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 67 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 109 110 35
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 26 (6.84%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 28 (7.37%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 65 (17.11%)
Isoleucine (Ile, I)
n = 30 (7.89%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 27 (7.11%)
Phenylalanine (Phe, F)
n = 29 (7.63%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 25 7 9 21 31 1 3 8 0 1 5 12 0 6 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 3 6 12 8 0 3 5 15 2 4 11 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 9 0 2 9 10 0 0 1 3 11 0 0 0 21 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 0 0 6 10 0 1 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 117 98 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 102 79 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 176 148 53
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.69%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 31 (9.54%)
Threonine (Thr, T)
n = 22 (6.77%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 13 (4.0%)
Leucine (Leu, L)
n = 64 (19.69%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 13 (4.0%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 13 (4.0%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 19 9 8 14 33 2 7 5 0 2 1 10 0 5 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 9 10 10 1 1 3 7 1 5 9 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 8 0 3 11 11 1 1 4 7 7 3 0 4 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 1 1 3 6 1 1 3 4 0 0 1 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 98 84 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 102 58 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 119 135 57
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 27 (7.8%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 49 (14.16%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 64 (18.5%)
Isoleucine (Ile, I)
n = 29 (8.38%)
Methionine (Met, M)
n = 20 (5.78%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 18 18 8 22 22 5 7 8 1 0 3 2 1 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 5 10 11 1 4 0 7 1 0 14 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 25 1 4 10 10 0 1 2 2 7 2 0 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 1 12 2 0 1 2 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 100 128 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 122 61 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 137 145 48
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.47%)
Alanine (Ala, A)
n = 27 (7.8%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 49 (14.16%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 6 (1.73%)
Leucine (Leu, L)
n = 64 (18.5%)
Isoleucine (Ile, I)
n = 29 (8.38%)
Methionine (Met, M)
n = 20 (5.78%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 18 18 8 22 22 5 7 8 1 0 3 2 1 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 5 10 11 1 4 0 7 1 0 14 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 25 1 4 10 10 0 1 2 2 7 2 0 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 0 0 1 12 2 0 1 2 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 100 128 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 122 61 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 137 145 48
ND4 (size: 1368 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.18%)
Alanine (Ala, A)
n = 33 (7.25%)
Serine (Ser, S)
n = 38 (8.35%)
Threonine (Thr, T)
n = 51 (11.21%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 7 (1.54%)
Leucine (Leu, L)
n = 104 (22.86%)
Isoleucine (Ile, I)
n = 37 (8.13%)
Methionine (Met, M)
n = 22 (4.84%)
Proline (Pro, P)
n = 28 (6.15%)
Phenylalanine (Phe, F)
n = 17 (3.74%)
Tyrosine (Tyr, Y)
n = 13 (2.86%)
Tryptophan (Trp, W)
n = 12 (2.64%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.98%)
Asparagine (Asn, N)
n = 14 (3.08%)
Glutamine (Gln, Q)
n = 13 (2.86%)
Histidine (His, H)
n = 12 (2.64%)
Lysine (Lys, K)
n = 9 (1.98%)
Arginine (Arg, R)
n = 12 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 27 20 6 30 53 1 14 11 2 2 3 2 0 3 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 14 15 0 5 7 6 1 1 15 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 20 0 4 10 12 0 3 9 4 9 0 0 2 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 2 1 1 9 0 0 3 8 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 155 146 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 138 72 187
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 191 201 54
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 11 (11.22%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 7 0 2 11 0 5 2 0 0 0 1 0 0 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 5 2 0 0 3 1 0 0 2 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 2 2 4 0 1 3 1 1 0 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 26 30 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 17 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 42 44 11
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.46%)
Alanine (Ala, A)
n = 50 (8.28%)
Serine (Ser, S)
n = 49 (8.11%)
Threonine (Thr, T)
n = 72 (11.92%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 11 (1.82%)
Leucine (Leu, L)
n = 109 (18.05%)
Isoleucine (Ile, I)
n = 52 (8.61%)
Methionine (Met, M)
n = 31 (5.13%)
Proline (Pro, P)
n = 30 (4.97%)
Phenylalanine (Phe, F)
n = 29 (4.8%)
Tyrosine (Tyr, Y)
n = 15 (2.48%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 27 (4.47%)
Glutamine (Gln, Q)
n = 16 (2.65%)
Histidine (His, H)
n = 12 (1.99%)
Lysine (Lys, K)
n = 21 (3.48%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 38 28 11 34 51 2 11 15 1 1 5 5 0 7 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 4 9 30 11 0 2 16 13 2 3 14 12 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 30 0 4 15 21 0 1 8 1 14 0 0 6 21 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 1 4 6 21 0 1 3 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 164 212 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 192 114 232
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 274 246 75
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.76%)
Alanine (Ala, A)
n = 12 (6.94%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 35 (20.23%)
Leucine (Leu, L)
n = 25 (14.45%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 13 (7.51%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 7 (4.05%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 1 5 0 0 3 6 0 0 15 0 5 15 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 4 0 7 1 7 2 4 16 3 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 7 0 1 2 2 0 6 1 5 11 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 4 0 0 1 2 0 0 3 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 17 18 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 28 16 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
68 6 27 73
Total protein-coding genes (size: 11386 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.9%)
Alanine (Ala, A)
n = 295 (7.78%)
Serine (Ser, S)
n = 285 (7.51%)
Threonine (Thr, T)
n = 351 (9.25%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 158 (4.16%)
Leucine (Leu, L)
n = 671 (17.69%)
Isoleucine (Ile, I)
n = 292 (7.7%)
Methionine (Met, M)
n = 169 (4.45%)
Proline (Pro, P)
n = 227 (5.98%)
Phenylalanine (Phe, F)
n = 217 (5.72%)
Tyrosine (Tyr, Y)
n = 116 (3.06%)
Tryptophan (Trp, W)
n = 109 (2.87%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 131 (3.45%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 106 (2.79%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
73 219 137 76 179 308 18 79 87 5 30 45 66 17 49 168
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
32 10 18 53 133 103 6 30 64 98 32 36 92 96 3 59
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
151 138 3 37 90 103 4 9 42 32 84 11 11 20 111 21
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
85 82 10 19 45 81 4 8 19 40 4 1 3 7 1 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
833 1077 1083 802
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
487 1107 694 1507
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
164 1545 1524 562

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.