Viewing data for Chlamydosaurus kingii


Scientific name Chlamydosaurus kingii
Common name Frilled dragon
Maximum lifespan 9.90 years (Chlamydosaurus kingii@AnAge)

Total mtDNA (size: 16761 bases) GC AT G C A T
Base content (bases) 6946 9815 4863 2083 4046 5769
Base content per 1 kb (bases) 414 586 290 124 241 344
Base content (%) 41.4% 58.6%
Total protein-coding genes (size: 11289 bases) GC AT G C A T
Base content (bases) 4648 6641 3410 1238 2725 3916
Base content per 1 kb (bases) 412 588 302 110 241 347
Base content (%) 41.2% 58.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1484 bases) GC AT G C A T
Base content (bases) 620 864 375 245 365 499
Base content per 1 kb (bases) 418 582 253 165 246 336
Base content (%) 41.8% 58.2%
Total rRNA-coding genes (size: 2407 bases) GC AT G C A T
Base content (bases) 1053 1354 637 416 459 895
Base content per 1 kb (bases) 437 563 265 173 191 372
Base content (%) 43.7% 56.3%
12S rRNA gene (size: 910 bases) GC AT G C A T
Base content (bases) 444 466 266 178 156 310
Base content per 1 kb (bases) 488 512 292 196 171 341
Base content (%) 48.8% 51.2%
16S rRNA gene (size: 1497 bases) GC AT G C A T
Base content (bases) 609 888 371 238 303 585
Base content per 1 kb (bases) 407 593 248 159 202 391
Base content (%) 40.7% 59.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 255 429 211 44 181 248
Base content per 1 kb (bases) 373 627 308 64 265 363
Base content (%) 37.3% 62.7%
ATP8 (size: 156 bases) GC AT G C A T
Base content (bases) 56 100 48 8 37 63
Base content per 1 kb (bases) 359 641 308 51 237 404
Base content (%) 35.9% 64.1%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 669 879 453 216 384 495
Base content per 1 kb (bases) 432 568 293 140 248 320
Base content (%) 43.2% 56.8%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 276 414 197 79 162 252
Base content per 1 kb (bases) 400 600 286 114 235 365
Base content (%) 40.0% 60.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 341 443 236 105 191 252
Base content per 1 kb (bases) 435 565 301 134 244 321
Base content (%) 43.5% 56.5%
CYTB (size: 1107 bases) GC AT G C A T
Base content (bases) 453 654 320 133 295 359
Base content per 1 kb (bases) 409 591 289 120 266 324
Base content (%) 40.9% 59.1%
ND1 (size: 999 bases) GC AT G C A T
Base content (bases) 414 585 294 120 246 339
Base content per 1 kb (bases) 414 586 294 120 246 339
Base content (%) 41.4% 58.6%
ND2 (size: 1033 bases) GC AT G C A T
Base content (bases) 431 602 337 94 227 375
Base content per 1 kb (bases) 417 583 326 91 220 363
Base content (%) 41.7% 58.3%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 147 196 111 36 85 111
Base content per 1 kb (bases) 429 571 324 105 248 324
Base content (%) 42.9% 57.1%
ND4 (size: 1371 bases) GC AT G C A T
Base content (bases) 551 820 408 143 337 483
Base content per 1 kb (bases) 402 598 298 104 246 352
Base content (%) 40.2% 59.8%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 106 185 80 26 71 114
Base content per 1 kb (bases) 364 636 275 89 244 392
Base content (%) 36.4% 63.6%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 731 1066 554 177 453 613
Base content per 1 kb (bases) 407 593 308 98 252 341
Base content (%) 40.7% 59.3%
ND6 (size: 501 bases) GC AT G C A T
Base content (bases) 220 281 161 59 61 220
Base content per 1 kb (bases) 439 561 321 118 122 439
Base content (%) 43.9% 56.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 37 (16.3%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 54 (23.79%)
Isoleucine (Ile, I)
n = 26 (11.45%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 3 (1.32%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (1.32%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 16 10 9 4 30 0 11 7 0 0 0 6 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 2 2 0 0 3 4 0 1 1 14 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 0 1 3 9 1 0 2 1 4 0 0 0 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 0 6 0 0 1 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 75 88 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 76 31 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 60 129 36
ATP8 (size: 156 bases)
Amino acid sequence: MPQLNPSPWFFVMVITWMTMILLITKLTTTQTHTTPTKTPKPNYTQSTWPW*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 2 (3.92%)
Threonine (Thr, T)
n = 13 (25.49%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.92%)
Leucine (Leu, L)
n = 4 (7.84%)
Isoleucine (Ile, I)
n = 3 (5.88%)
Methionine (Met, M)
n = 4 (7.84%)
Proline (Pro, P)
n = 7 (13.73%)
Phenylalanine (Phe, F)
n = 2 (3.92%)
Tyrosine (Tyr, Y)
n = 1 (1.96%)
Tryptophan (Trp, W)
n = 4 (7.84%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.92%)
Glutamine (Gln, Q)
n = 3 (5.88%)
Histidine (His, H)
n = 1 (1.96%)
Lysine (Lys, K)
n = 3 (5.88%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 3 2 0 2 0 0 3 0 2 0 0 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 0 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 6 0 0 2 0 0 0 0 1 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 2 1 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 15 25 10
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 22 11 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 11 27 12
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 42 (8.16%)
Alanine (Ala, A)
n = 40 (7.77%)
Serine (Ser, S)
n = 40 (7.77%)
Threonine (Thr, T)
n = 47 (9.13%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 26 (5.05%)
Leucine (Leu, L)
n = 53 (10.29%)
Isoleucine (Ile, I)
n = 41 (7.96%)
Methionine (Met, M)
n = 34 (6.6%)
Proline (Pro, P)
n = 31 (6.02%)
Phenylalanine (Phe, F)
n = 42 (8.16%)
Tyrosine (Tyr, Y)
n = 15 (2.91%)
Tryptophan (Trp, W)
n = 18 (3.5%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 4 (0.78%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 12 (2.33%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 26 29 10 7 28 1 7 12 0 0 9 17 0 13 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 13 20 1 3 8 29 2 0 5 25 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 24 1 3 12 17 1 0 7 4 11 0 0 5 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 4 0 1 13 8 1 0 1 7 0 1 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
126 117 157 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 151 92 196
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 185 246 72
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 12 (5.24%)
Serine (Ser, S)
n = 19 (8.3%)
Threonine (Thr, T)
n = 25 (10.92%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 8 (3.49%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 16 (6.99%)
Proline (Pro, P)
n = 12 (5.24%)
Phenylalanine (Phe, F)
n = 12 (5.24%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 9 (3.93%)
Glutamic acid (Glu, E)
n = 13 (5.68%)
Asparagine (Asn, N)
n = 9 (3.93%)
Glutamine (Gln, Q)
n = 6 (2.62%)
Histidine (His, H)
n = 7 (3.06%)
Lysine (Lys, K)
n = 5 (2.18%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 15 2 4 16 0 4 5 1 1 4 3 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 5 5 0 1 1 6 0 0 2 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 0 1 0 15 0 0 3 5 4 0 0 3 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 2 2 7 4 1 1 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 53 78 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 65 59 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 79 115 31
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 29 (11.15%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 11 (4.23%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 8 (3.08%)
Tryptophan (Trp, W)
n = 13 (5.0%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 8 (3.08%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 8 3 5 19 2 3 8 1 3 2 6 0 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 1 10 5 0 0 5 14 0 0 2 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 12 0 1 3 9 0 0 2 1 7 0 0 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 2 1 4 8 0 0 1 4 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 70 70 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 70 57 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 96 125 34
CYTB (size: 1107 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.25%)
Alanine (Ala, A)
n = 28 (7.61%)
Serine (Ser, S)
n = 23 (6.25%)
Threonine (Thr, T)
n = 39 (10.6%)
Cysteine (Cys, C)
n = 2 (0.54%)
Valine (Val, V)
n = 11 (2.99%)
Leucine (Leu, L)
n = 41 (11.14%)
Isoleucine (Ile, I)
n = 35 (9.51%)
Methionine (Met, M)
n = 26 (7.07%)
Proline (Pro, P)
n = 24 (6.52%)
Phenylalanine (Phe, F)
n = 29 (7.88%)
Tyrosine (Tyr, Y)
n = 12 (3.26%)
Tryptophan (Trp, W)
n = 11 (2.99%)
Aspartic acid (Asp, D)
n = 7 (1.9%)
Glutamic acid (Glu, E)
n = 6 (1.63%)
Asparagine (Asn, N)
n = 12 (3.26%)
Glutamine (Gln, Q)
n = 5 (1.36%)
Histidine (His, H)
n = 13 (3.53%)
Lysine (Lys, K)
n = 12 (3.26%)
Arginine (Arg, R)
n = 9 (2.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 21 25 13 5 15 1 7 5 0 2 1 8 0 17 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 13 13 0 1 11 10 1 0 5 17 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 15 1 1 5 12 0 3 2 4 8 1 0 2 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 5 2 12 0 1 1 7 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 85 129 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 109 68 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 126 162 73
ND1 (size: 999 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.82%)
Alanine (Ala, A)
n = 22 (6.63%)
Serine (Ser, S)
n = 27 (8.13%)
Threonine (Thr, T)
n = 36 (10.84%)
Cysteine (Cys, C)
n = 2 (0.6%)
Valine (Val, V)
n = 6 (1.81%)
Leucine (Leu, L)
n = 56 (16.87%)
Isoleucine (Ile, I)
n = 22 (6.63%)
Methionine (Met, M)
n = 21 (6.33%)
Proline (Pro, P)
n = 26 (7.83%)
Phenylalanine (Phe, F)
n = 15 (4.52%)
Tyrosine (Tyr, Y)
n = 11 (3.31%)
Tryptophan (Trp, W)
n = 8 (2.41%)
Aspartic acid (Asp, D)
n = 5 (1.51%)
Glutamic acid (Glu, E)
n = 12 (3.61%)
Asparagine (Asn, N)
n = 12 (3.61%)
Glutamine (Gln, Q)
n = 10 (3.01%)
Histidine (His, H)
n = 7 (2.11%)
Lysine (Lys, K)
n = 10 (3.01%)
Arginine (Arg, R)
n = 8 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 10 18 9 4 23 4 15 9 1 1 2 3 0 5 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 0 14 7 1 0 5 10 1 6 6 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 22 0 3 5 11 1 1 6 4 7 0 1 2 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 8 4 2 3 9 1 1 1 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 91 108 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 104 68 120
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 99 163 53
ND2 (size: 1033 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.79%)
Alanine (Ala, A)
n = 29 (8.45%)
Serine (Ser, S)
n = 29 (8.45%)
Threonine (Thr, T)
n = 53 (15.45%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.04%)
Leucine (Leu, L)
n = 60 (17.49%)
Isoleucine (Ile, I)
n = 35 (10.2%)
Methionine (Met, M)
n = 20 (5.83%)
Proline (Pro, P)
n = 18 (5.25%)
Phenylalanine (Phe, F)
n = 9 (2.62%)
Tyrosine (Tyr, Y)
n = 8 (2.33%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 3 (0.87%)
Asparagine (Asn, N)
n = 12 (3.5%)
Glutamine (Gln, Q)
n = 12 (3.5%)
Histidine (His, H)
n = 7 (2.04%)
Lysine (Lys, K)
n = 12 (3.5%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 24 19 9 7 36 2 6 11 1 2 0 5 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 19 8 0 0 3 9 1 0 2 16 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 31 1 2 7 17 0 0 3 2 6 2 0 2 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 0 1 1 11 1 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 95 135 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 126 56 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 116 184 35
ND3 (size: 1033 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.79%)
Alanine (Ala, A)
n = 29 (8.45%)
Serine (Ser, S)
n = 29 (8.45%)
Threonine (Thr, T)
n = 53 (15.45%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.04%)
Leucine (Leu, L)
n = 60 (17.49%)
Isoleucine (Ile, I)
n = 35 (10.2%)
Methionine (Met, M)
n = 20 (5.83%)
Proline (Pro, P)
n = 18 (5.25%)
Phenylalanine (Phe, F)
n = 9 (2.62%)
Tyrosine (Tyr, Y)
n = 8 (2.33%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 3 (0.87%)
Asparagine (Asn, N)
n = 12 (3.5%)
Glutamine (Gln, Q)
n = 12 (3.5%)
Histidine (His, H)
n = 7 (2.04%)
Lysine (Lys, K)
n = 12 (3.5%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 24 19 9 7 36 2 6 11 1 2 0 5 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 19 8 0 0 3 9 1 0 2 16 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 31 1 2 7 17 0 0 3 2 6 2 0 2 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 0 1 1 11 1 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 95 135 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 126 56 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 116 184 35
ND4 (size: 1371 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.95%)
Alanine (Ala, A)
n = 37 (8.11%)
Serine (Ser, S)
n = 33 (7.24%)
Threonine (Thr, T)
n = 48 (10.53%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 10 (2.19%)
Leucine (Leu, L)
n = 91 (19.96%)
Isoleucine (Ile, I)
n = 32 (7.02%)
Methionine (Met, M)
n = 41 (8.99%)
Proline (Pro, P)
n = 24 (5.26%)
Phenylalanine (Phe, F)
n = 14 (3.07%)
Tyrosine (Tyr, Y)
n = 14 (3.07%)
Tryptophan (Trp, W)
n = 8 (1.75%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 11 (2.41%)
Asparagine (Asn, N)
n = 17 (3.73%)
Glutamine (Gln, Q)
n = 14 (3.07%)
Histidine (His, H)
n = 12 (2.63%)
Lysine (Lys, K)
n = 15 (3.29%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 21 36 18 19 35 4 15 14 0 1 1 8 0 5 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 2 4 16 16 1 2 2 12 2 1 3 19 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 28 0 3 7 15 1 2 5 3 11 1 0 5 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 0 3 14 1 1 3 6 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 136 160 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 135 87 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 137 236 67
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 6 (6.25%)
Serine (Ser, S)
n = 7 (7.29%)
Threonine (Thr, T)
n = 17 (17.71%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 3 (3.13%)
Leucine (Leu, L)
n = 18 (18.75%)
Isoleucine (Ile, I)
n = 4 (4.17%)
Methionine (Met, M)
n = 13 (13.54%)
Proline (Pro, P)
n = 2 (2.08%)
Phenylalanine (Phe, F)
n = 3 (3.13%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 8 (8.33%)
Glutamine (Gln, Q)
n = 1 (1.04%)
Histidine (His, H)
n = 1 (1.04%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 1 (1.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 13 3 0 9 2 4 1 0 0 1 2 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 1 1 3 2 0 0 0 2 1 0 0 2 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 5 0 1 1 3 0 0 2 1 0 0 0 2 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 3 0 0 1 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
15 19 47 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 30 18 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 31 49 14
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (3.85%)
Alanine (Ala, A)
n = 49 (8.19%)
Serine (Ser, S)
n = 47 (7.86%)
Threonine (Thr, T)
n = 85 (14.21%)
Cysteine (Cys, C)
n = 8 (1.34%)
Valine (Val, V)
n = 17 (2.84%)
Leucine (Leu, L)
n = 96 (16.05%)
Isoleucine (Ile, I)
n = 55 (9.2%)
Methionine (Met, M)
n = 34 (5.69%)
Proline (Pro, P)
n = 29 (4.85%)
Phenylalanine (Phe, F)
n = 25 (4.18%)
Tyrosine (Tyr, Y)
n = 14 (2.34%)
Tryptophan (Trp, W)
n = 9 (1.51%)
Aspartic acid (Asp, D)
n = 10 (1.67%)
Glutamic acid (Glu, E)
n = 7 (1.17%)
Asparagine (Asn, N)
n = 22 (3.68%)
Glutamine (Gln, Q)
n = 20 (3.34%)
Histidine (His, H)
n = 14 (2.34%)
Lysine (Lys, K)
n = 26 (4.35%)
Arginine (Arg, R)
n = 8 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 25 30 13 12 52 3 16 20 0 3 6 8 0 13 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 5 10 20 17 2 3 6 12 2 6 4 19 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
42 31 1 4 15 20 0 1 7 4 10 0 0 7 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 1 2 8 25 1 1 3 4 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 151 230 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 202 114 227
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 201 269 114
ND6 (size: 501 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (18.07%)
Alanine (Ala, A)
n = 16 (9.64%)
Serine (Ser, S)
n = 11 (6.63%)
Threonine (Thr, T)
n = 1 (0.6%)
Cysteine (Cys, C)
n = 3 (1.81%)
Valine (Val, V)
n = 22 (13.25%)
Leucine (Leu, L)
n = 26 (15.66%)
Isoleucine (Ile, I)
n = 5 (3.01%)
Methionine (Met, M)
n = 5 (3.01%)
Proline (Pro, P)
n = 3 (1.81%)
Phenylalanine (Phe, F)
n = 19 (11.45%)
Tyrosine (Tyr, Y)
n = 9 (5.42%)
Tryptophan (Trp, W)
n = 3 (1.81%)
Aspartic acid (Asp, D)
n = 2 (1.2%)
Glutamic acid (Glu, E)
n = 3 (1.81%)
Asparagine (Asn, N)
n = 3 (1.81%)
Glutamine (Gln, Q)
n = 1 (0.6%)
Histidine (His, H)
n = 1 (0.6%)
Lysine (Lys, K)
n = 1 (0.6%)
Arginine (Arg, R)
n = 2 (1.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 2 3 0 1 4 7 1 0 13 0 5 4 15 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 10 0 2 4 11 4 4 11 2 0 0 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 8 0 1 2 0 0 6 3 2 11 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 1 1 0 1 0 0 0 2 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 15 16 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 31 20 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 13 25 80
Total protein-coding genes (size: 11304 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 206 (5.47%)
Alanine (Ala, A)
n = 276 (7.33%)
Serine (Ser, S)
n = 276 (7.33%)
Threonine (Thr, T)
n = 439 (11.66%)
Cysteine (Cys, C)
n = 27 (0.72%)
Valine (Val, V)
n = 129 (3.43%)
Leucine (Leu, L)
n = 579 (15.37%)
Isoleucine (Ile, I)
n = 306 (8.13%)
Methionine (Met, M)
n = 240 (6.37%)
Proline (Pro, P)
n = 215 (5.71%)
Phenylalanine (Phe, F)
n = 209 (5.55%)
Tyrosine (Tyr, Y)
n = 109 (2.89%)
Tryptophan (Trp, W)
n = 96 (2.55%)
Aspartic acid (Asp, D)
n = 60 (1.59%)
Glutamic acid (Glu, E)
n = 76 (2.02%)
Asparagine (Asn, N)
n = 128 (3.4%)
Glutamine (Gln, Q)
n = 104 (2.76%)
Histidine (His, H)
n = 102 (2.71%)
Lysine (Lys, K)
n = 113 (3.0%)
Arginine (Arg, R)
n = 67 (1.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
128 178 214 95 70 282 23 97 100 4 28 26 71 4 92 117
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 11 16 43 121 103 9 21 48 115 22 17 31 160 7 52
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
174 209 4 29 63 131 7 7 39 37 72 7 12 32 96 23
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
79 63 13 15 45 105 8 5 15 45 2 1 1 6 2 89
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
747 958 1274 788
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
444 1160 700 1463
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
151 1190 1791 635

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.