Viewing data for Batrachuperus mustersi


Scientific name Batrachuperus mustersi
Common name Afghanistan salamander
Maximum lifespan 11.00 years (Batrachuperus mustersi@AnAge)

Total mtDNA (size: 16383 bases) GC AT G C A T
Base content (bases) 5603 10767 3353 2250 5297 5470
Base content per 1 kb (bases) 342 657 205 137 323 334
Base content (%) 34.2% 65.7%
Total protein-coding genes (size: 11364 bases) GC AT G C A T
Base content (bases) 3865 7499 2411 1454 3828 3671
Base content per 1 kb (bases) 340 660 212 128 337 323
Base content (%) 34.0% 66.0%
D-loop (size: 799 bases) GC AT G C A T
Base content (bases) 270 528 148 122 275 253
Base content per 1 kb (bases) 338 661 185 153 344 317
Base content (%) 33.8% 66.1%
Total tRNA-coding genes (size: 1527 bases) GC AT G C A T
Base content (bases) 549 978 309 240 456 522
Base content per 1 kb (bases) 360 640 202 157 299 342
Base content (%) 36.0% 64.0%
Total rRNA-coding genes (size: 2537 bases) GC AT G C A T
Base content (bases) 852 1685 447 405 698 987
Base content per 1 kb (bases) 336 664 176 160 275 389
Base content (%) 33.6% 66.4%
12S rRNA gene (size: 934 bases) GC AT G C A T
Base content (bases) 355 579 194 161 240 339
Base content per 1 kb (bases) 380 620 208 172 257 363
Base content (%) 38.0% 62.0%
16S rRNA gene (size: 1603 bases) GC AT G C A T
Base content (bases) 497 1106 253 244 458 648
Base content per 1 kb (bases) 310 690 158 152 286 404
Base content (%) 31.0% 69.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 212 472 140 72 243 229
Base content per 1 kb (bases) 310 690 205 105 355 335
Base content (%) 31.0% 69.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 42 126 27 15 61 65
Base content per 1 kb (bases) 250 750 161 89 363 387
Base content (%) 25.0% 75.0%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 587 964 323 264 540 424
Base content per 1 kb (bases) 378 622 208 170 348 273
Base content (%) 37.8% 62.2%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 228 460 135 93 225 235
Base content per 1 kb (bases) 331 669 196 135 327 342
Base content (%) 33.1% 66.9%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 284 501 159 125 272 229
Base content per 1 kb (bases) 362 638 203 159 346 292
Base content (%) 36.2% 63.8%
CYTB (size: 1142 bases) GC AT G C A T
Base content (bases) 467 675 304 163 354 321
Base content per 1 kb (bases) 409 591 266 143 310 281
Base content (%) 40.9% 59.1%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 308 664 187 121 358 306
Base content per 1 kb (bases) 317 683 192 124 368 315
Base content (%) 31.7% 68.3%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 301 743 212 89 374 369
Base content per 1 kb (bases) 288 712 203 85 358 353
Base content (%) 28.8% 71.2%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 113 238 66 47 132 106
Base content per 1 kb (bases) 322 678 188 134 376 302
Base content (%) 32.2% 67.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 469 909 303 166 455 454
Base content per 1 kb (bases) 340 660 220 120 330 329
Base content (%) 34.0% 66.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 96 201 56 40 113 88
Base content per 1 kb (bases) 323 677 189 135 380 296
Base content (%) 32.3% 67.7%
ND5 (size: 1819 bases) GC AT G C A T
Base content (bases) 588 1231 377 211 612 619
Base content per 1 kb (bases) 323 677 207 116 336 340
Base content (%) 32.3% 67.7%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 181 338 127 54 100 238
Base content per 1 kb (bases) 349 651 245 104 193 459
Base content (%) 34.9% 65.1%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 14 (6.17%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 4 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 3 12 10 1 11 0 30 9 0 4 1 6 0 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 4 5 1 3 1 3 2 4 1 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 1 1 0 4 0 2 2 3 0 1 1 6 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 2 0 4 1 0 1 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 54 75 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 58 36 112
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 28 118 72
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPGPWFAIFLLSWAVFLFILTFKIIKFNNLNEPTSQNIKKNKPESWNWPWI*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 2 (3.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 6 (10.91%)
Phenylalanine (Phe, F)
n = 6 (10.91%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 7 (12.73%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 1 0 0 0 0 0 6 2 0 0 0 1 0 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 0 0 0 0 0 0 1 3 0 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 0 1 2 0 0 0 0 0 0 0 4 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 0 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 8 21 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 13 17 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 6 27 20
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.72%)
Alanine (Ala, A)
n = 41 (7.95%)
Serine (Ser, S)
n = 36 (6.98%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 60 (11.63%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 30 (5.81%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 8 26 13 5 5 4 32 5 2 16 5 14 4 31 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 14 11 15 1 8 8 17 12 11 5 11 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 16 2 9 4 16 1 1 5 13 5 2 1 9 6 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 0 9 6 8 0 2 0 5 2 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 90 135 142
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 135 93 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 98 196 187
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 14 (6.14%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.14%)
Leucine (Leu, L)
n = 24 (10.53%)
Isoleucine (Ile, I)
n = 21 (9.21%)
Methionine (Met, M)
n = 17 (7.46%)
Proline (Pro, P)
n = 13 (5.7%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 10 (4.39%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 8 (3.51%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 7 (3.07%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 3 15 3 0 5 0 15 8 1 8 1 4 1 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 6 0 10 0 2 1 5 0 2 2 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 0 4 3 8 0 0 3 7 1 0 1 9 1 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 2 5 5 3 0 0 4 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 45 68 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 61 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 32 106 84
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 28 (10.77%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 26 (10.0%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 1 11 6 5 4 0 13 8 0 8 1 5 4 22 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 6 11 0 3 2 16 0 4 3 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 14 0 4 2 6 0 1 2 8 3 0 0 1 2 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 2 3 3 2 0 1 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 54 57 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 62 53 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 43 118 92
CYTB (size: 1142 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 28 (7.39%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 32 (8.44%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 17 13 12 11 13 5 13 8 1 4 2 9 2 21 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 4 11 11 1 2 8 14 3 7 5 9 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 1 7 6 11 2 1 1 8 7 1 0 9 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 3 6 8 2 0 2 4 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 93 100 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 100 78 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 111 142 103
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 21 (6.5%)
Serine (Ser, S)
n = 27 (8.36%)
Threonine (Thr, T)
n = 21 (6.5%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 14 (4.33%)
Leucine (Leu, L)
n = 56 (17.34%)
Isoleucine (Ile, I)
n = 31 (9.6%)
Methionine (Met, M)
n = 18 (5.57%)
Proline (Pro, P)
n = 21 (6.5%)
Phenylalanine (Phe, F)
n = 22 (6.81%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 7 (2.17%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.41%)
Asparagine (Asn, N)
n = 15 (4.64%)
Glutamine (Gln, Q)
n = 7 (2.17%)
Histidine (His, H)
n = 3 (0.93%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 3 17 11 3 11 1 29 5 2 7 0 6 1 21 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 5 4 12 0 4 6 4 4 5 2 14 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 13 1 5 4 15 0 2 1 10 2 1 1 11 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 3 0 6 1 2 0 6 0 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 65 95 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 87 59 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 35 152 120
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.75%)
Alanine (Ala, A)
n = 23 (6.63%)
Serine (Ser, S)
n = 34 (9.8%)
Threonine (Thr, T)
n = 24 (6.92%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.15%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 40 (11.53%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 9 (2.59%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
38 2 30 17 1 10 0 40 10 0 2 0 2 0 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 5 12 1 3 1 7 2 3 5 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 13 0 6 7 16 0 1 4 3 4 0 1 11 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 2 9 2 0 0 2 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 67 131 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 93 62 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 52 176 110
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.75%)
Alanine (Ala, A)
n = 23 (6.63%)
Serine (Ser, S)
n = 34 (9.8%)
Threonine (Thr, T)
n = 24 (6.92%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.15%)
Leucine (Leu, L)
n = 69 (19.88%)
Isoleucine (Ile, I)
n = 40 (11.53%)
Methionine (Met, M)
n = 33 (9.51%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 10 (2.88%)
Histidine (His, H)
n = 9 (2.59%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
38 2 30 17 1 10 0 40 10 0 2 0 2 0 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 5 12 1 3 1 7 2 3 5 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 13 0 6 7 16 0 1 4 3 4 0 1 11 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 2 9 2 0 0 2 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 67 131 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 93 62 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 52 176 110
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.8%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 45 (9.83%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 25 (5.46%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 15 (3.28%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
38 7 27 8 8 21 6 46 9 1 5 2 4 0 15 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 1 6 22 1 0 6 12 4 8 4 11 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 1 7 7 14 2 4 3 9 3 2 3 14 7 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 3 1 2 11 0 2 1 6 2 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 101 154 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
58 123 79 199
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 79 221 127
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 9 (9.18%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 6 3 1 6 0 9 2 0 0 0 1 1 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 0 2 2 3 1 1 0 3 1 1 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 0 4 0 0 1 0 2 1 1 0 2 2 0 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 1 0 1 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 20 28 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 24 16 46
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 12 44 35
ND5 (size: 1819 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 44 (7.27%)
Serine (Ser, S)
n = 50 (8.26%)
Threonine (Thr, T)
n = 44 (7.27%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 21 (3.47%)
Leucine (Leu, L)
n = 87 (14.38%)
Isoleucine (Ile, I)
n = 56 (9.26%)
Methionine (Met, M)
n = 48 (7.93%)
Proline (Pro, P)
n = 23 (3.8%)
Phenylalanine (Phe, F)
n = 48 (7.93%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 13 (2.15%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 36 (5.95%)
Glutamine (Gln, Q)
n = 20 (3.31%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 25 (4.13%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
47 9 42 13 8 23 1 37 17 3 6 3 9 3 38 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 5 5 10 28 1 3 8 13 5 4 7 12 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 1 12 6 23 0 2 7 9 3 2 5 24 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 1 8 3 24 1 2 2 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
117 110 218 161
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 152 129 260
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 115 272 190
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.21%)
Alanine (Ala, A)
n = 11 (6.4%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 4 (2.33%)
Valine (Val, V)
n = 20 (11.63%)
Leucine (Leu, L)
n = 31 (18.02%)
Isoleucine (Ile, I)
n = 7 (4.07%)
Methionine (Met, M)
n = 8 (4.65%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 15 (8.72%)
Tyrosine (Tyr, Y)
n = 13 (7.56%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 1 (0.58%)
Glutamic acid (Glu, E)
n = 6 (3.49%)
Asparagine (Asn, N)
n = 4 (2.33%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 0 6 4 0 2 2 20 0 0 10 1 6 3 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 4 0 5 2 2 2 7 0 2 12 3 1 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 6 1 4 1 3 0 12 1 0 3 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 6 1 0 0 0 2 0 1 0 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 15 27 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 31 24 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 8 49 85
Total protein-coding genes (size: 11398 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.9%)
Alanine (Ala, A)
n = 265 (6.98%)
Serine (Ser, S)
n = 290 (7.64%)
Threonine (Thr, T)
n = 261 (6.88%)
Cysteine (Cys, C)
n = 26 (0.68%)
Valine (Val, V)
n = 174 (4.58%)
Leucine (Leu, L)
n = 604 (15.91%)
Isoleucine (Ile, I)
n = 337 (8.88%)
Methionine (Met, M)
n = 242 (6.38%)
Proline (Pro, P)
n = 198 (5.22%)
Phenylalanine (Phe, F)
n = 264 (6.95%)
Tyrosine (Tyr, Y)
n = 116 (3.06%)
Tryptophan (Trp, W)
n = 114 (3.0%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 97 (2.56%)
Asparagine (Asn, N)
n = 159 (4.19%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 97 (2.56%)
Lysine (Lys, K)
n = 89 (2.34%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
280 57 209 104 45 113 19 305 85 10 70 16 69 19 213 51
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 14 12 58 63 135 9 37 42 99 46 56 35 99 8 63
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
62 129 7 66 44 124 7 19 30 85 31 12 18 104 55 43
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
54 80 17 37 29 82 7 11 10 41 9 1 0 6 1 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
826 742 1138 1091
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
485 965 726 1621
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
222 636 1679 1260

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.