Viewing data for Arctonyx collaris


Scientific name Arctonyx collaris
Common name Hog badger
Maximum lifespan 15.80 years (Arctonyx collaris@AnAge)

Total mtDNA (size: 16481 bases) GC AT G C A T
Base content (bases) 6329 10152 4167 2162 4613 5539
Base content per 1 kb (bases) 384 616 253 131 280 336
Base content (%) 38.4% 61.6%
Total protein-coding genes (size: 11354 bases) GC AT G C A T
Base content (bases) 4396 6958 3038 1358 3268 3690
Base content per 1 kb (bases) 387 613 268 120 288 325
Base content (%) 38.7% 61.3%
D-loop (size: 1034 bases) GC AT G C A T
Base content (bases) 406 628 280 126 275 353
Base content per 1 kb (bases) 393 607 271 122 266 341
Base content (%) 39.3% 60.7%
Total tRNA-coding genes (size: 1507 bases) GC AT G C A T
Base content (bases) 546 961 312 234 427 534
Base content per 1 kb (bases) 362 638 207 155 283 354
Base content (%) 36.2% 63.8%
Total rRNA-coding genes (size: 2537 bases) GC AT G C A T
Base content (bases) 955 1582 521 434 632 950
Base content per 1 kb (bases) 376 624 205 171 249 374
Base content (%) 37.6% 62.4%
12S rRNA gene (size: 960 bases) GC AT G C A T
Base content (bases) 371 589 204 167 231 358
Base content per 1 kb (bases) 386 614 213 174 241 373
Base content (%) 38.6% 61.4%
16S rRNA gene (size: 1577 bases) GC AT G C A T
Base content (bases) 584 993 317 267 401 592
Base content per 1 kb (bases) 370 630 201 169 254 375
Base content (%) 37.0% 63.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 262 419 188 74 205 214
Base content per 1 kb (bases) 385 615 276 109 301 314
Base content (%) 38.5% 61.5%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 61 146 47 14 61 85
Base content per 1 kb (bases) 295 705 227 68 295 411
Base content (%) 29.5% 70.5%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 613 932 357 256 484 448
Base content per 1 kb (bases) 397 603 231 166 313 290
Base content (%) 39.7% 60.3%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 257 427 165 92 196 231
Base content per 1 kb (bases) 376 624 241 135 287 338
Base content (%) 37.6% 62.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 331 453 215 116 238 215
Base content per 1 kb (bases) 422 578 274 148 304 274
Base content (%) 42.2% 57.8%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 465 675 327 138 328 347
Base content per 1 kb (bases) 408 592 287 121 288 304
Base content (%) 40.8% 59.2%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 373 582 264 109 279 303
Base content per 1 kb (bases) 391 609 276 114 292 317
Base content (%) 39.1% 60.9%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 365 677 269 96 291 386
Base content per 1 kb (bases) 350 650 258 92 279 370
Base content (%) 35.0% 65.0%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 136 212 93 43 99 113
Base content per 1 kb (bases) 391 609 267 124 284 325
Base content (%) 39.1% 60.9%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 533 845 386 147 391 454
Base content per 1 kb (bases) 387 613 280 107 284 329
Base content (%) 38.7% 61.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 111 186 77 34 102 84
Base content per 1 kb (bases) 374 626 259 114 343 283
Base content (%) 37.4% 62.6%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 703 1127 509 194 515 612
Base content per 1 kb (bases) 384 616 278 106 281 334
Base content (%) 38.4% 61.6%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 207 327 156 51 103 224
Base content per 1 kb (bases) 388 612 292 96 193 419
Base content (%) 38.8% 61.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 28 (12.39%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 10 (4.42%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 12 9 3 4 17 3 14 9 1 0 4 6 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 8 6 0 1 3 5 1 3 3 6 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 6 0 3 6 2 0 2 3 1 1 0 1 5 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 4 0 0 0 3 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 60 82 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 60 39 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 68 93 54
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDTSTWFITILSMIITLFFMFQLKVSKYYFPENPKQELTTMPKTTTPWEEKWTKIYFPLSLPQQL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (5.88%)
Threonine (Thr, T)
n = 10 (14.71%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.47%)
Leucine (Leu, L)
n = 8 (11.76%)
Isoleucine (Ile, I)
n = 5 (7.35%)
Methionine (Met, M)
n = 4 (5.88%)
Proline (Pro, P)
n = 7 (10.29%)
Phenylalanine (Phe, F)
n = 6 (8.82%)
Tyrosine (Tyr, Y)
n = 3 (4.41%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 4 (5.88%)
Asparagine (Asn, N)
n = 1 (1.47%)
Glutamine (Gln, Q)
n = 5 (7.35%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 6 (8.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 3 1 0 4 0 3 5 0 0 0 0 1 6 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 1 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 2 0 0 4 0 0 0 2 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 0 1 0 6 0 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 26 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 21 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 9 38 17
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 32 (6.23%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.98%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 35 (6.81%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 13 29 8 4 29 2 14 5 1 10 8 17 6 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 10 10 18 2 13 6 23 5 11 8 9 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 20 2 5 10 12 2 2 1 8 11 1 1 9 8 15
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 9 1 9 6 9 0 0 1 7 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 103 135 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 119 218 151
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 8 13 3 2 17 0 11 6 1 2 1 8 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 1 6 2 0 1 1 4 2 4 3 6 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 4 4 7 0 2 3 5 5 1 1 2 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 12 3 5 5 4 1 1 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 56 68 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 54 61 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 55 102 58
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 13 (5.0%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 9 8 8 5 11 2 5 6 1 5 3 8 0 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 7 4 0 6 4 8 3 3 2 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 0 5 5 8 0 0 3 9 5 1 1 3 4 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 2 2 1 2 0 1 2 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 65 60 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 84 98 67
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 14 (3.69%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 43 (11.35%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 19 (5.01%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 25 11 3 13 22 2 17 6 0 2 3 8 1 10 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 5 10 8 0 3 6 14 1 2 7 15 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 12 0 7 7 9 1 1 2 6 10 0 0 6 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 1 4 6 8 1 1 1 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 89 116 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 99 77 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 139 154 78
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 19 (5.99%)
Threonine (Thr, T)
n = 22 (6.94%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 57 (17.98%)
Isoleucine (Ile, I)
n = 32 (10.09%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 19 (5.99%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 18 18 5 5 23 2 22 6 1 3 4 4 2 6 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 14 10 0 1 4 5 2 3 8 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 0 2 6 9 0 0 2 7 5 0 0 5 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 0 3 7 0 1 1 5 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 75 95 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 90 56 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 99 152 57
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 58 (16.76%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 36 (10.4%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 32 6 8 22 2 19 8 0 1 3 6 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 4 9 1 1 3 10 2 2 10 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 24 0 1 7 17 0 0 1 5 3 1 1 6 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 0 0 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 74 145 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 104 58 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 91 183 59
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 39 (11.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 58 (16.76%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 36 (10.4%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 32 6 8 22 2 19 8 0 1 3 6 1 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 6 4 9 1 1 3 10 2 2 10 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 24 0 1 7 17 0 0 1 5 3 1 1 6 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 1 0 0 12 1 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 74 145 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 104 58 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 91 183 59
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 35 (7.64%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 36 (7.86%)
Methionine (Met, M)
n = 40 (8.73%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 16 (3.49%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 36 13 15 42 4 21 11 0 0 3 10 3 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 4 17 9 2 1 8 8 0 5 9 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 1 7 8 11 0 2 7 7 9 0 2 11 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 0 0 3 11 2 4 2 4 0 0 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 127 158 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 115 86 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 144 210 87
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 5 8 5 1 9 0 6 1 1 2 1 3 0 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 4 2 0 0 2 2 0 1 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 1 6 2 0 1 0 1 3 0 1 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 21 28 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 33 39 23
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.6%)
Alanine (Ala, A)
n = 36 (5.91%)
Serine (Ser, S)
n = 47 (7.72%)
Threonine (Thr, T)
n = 62 (10.18%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 19 (3.12%)
Leucine (Leu, L)
n = 93 (15.27%)
Isoleucine (Ile, I)
n = 56 (9.2%)
Methionine (Met, M)
n = 44 (7.22%)
Proline (Pro, P)
n = 24 (3.94%)
Phenylalanine (Phe, F)
n = 45 (7.39%)
Tyrosine (Tyr, Y)
n = 16 (2.63%)
Tryptophan (Trp, W)
n = 12 (1.97%)
Aspartic acid (Asp, D)
n = 11 (1.81%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 31 (5.09%)
Glutamine (Gln, Q)
n = 20 (3.28%)
Histidine (His, H)
n = 17 (2.79%)
Lysine (Lys, K)
n = 24 (3.94%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 32 40 14 13 40 6 20 16 4 1 5 11 2 18 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 1 6 16 14 0 2 9 16 1 7 8 9 0 17
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 22 1 2 16 16 1 2 10 5 11 1 0 13 18 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 3 4 7 23 1 1 3 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 143 229 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 157 131 257
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 209 252 125
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.56%)
Alanine (Ala, A)
n = 10 (5.65%)
Serine (Ser, S)
n = 14 (7.91%)
Threonine (Thr, T)
n = 8 (4.52%)
Cysteine (Cys, C)
n = 2 (1.13%)
Valine (Val, V)
n = 25 (14.12%)
Leucine (Leu, L)
n = 21 (11.86%)
Isoleucine (Ile, I)
n = 15 (8.47%)
Methionine (Met, M)
n = 8 (4.52%)
Proline (Pro, P)
n = 3 (1.69%)
Phenylalanine (Phe, F)
n = 12 (6.78%)
Tyrosine (Tyr, Y)
n = 9 (5.08%)
Tryptophan (Trp, W)
n = 4 (2.26%)
Aspartic acid (Asp, D)
n = 5 (2.82%)
Glutamic acid (Glu, E)
n = 8 (4.52%)
Asparagine (Asn, N)
n = 3 (1.69%)
Glutamine (Gln, Q)
n = 1 (0.56%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.26%)
Arginine (Arg, R)
n = 1 (0.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 1 3 3 0 4 2 4 0 1 15 1 5 4 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 8 0 0 2 9 0 4 11 2 1 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 6 0 1 1 5 1 7 2 3 8 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 7 5 0 3 1 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 14 44 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 29 31 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 8 28 95
Total protein-coding genes (size: 11425 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.62%)
Alanine (Ala, A)
n = 247 (6.49%)
Serine (Ser, S)
n = 279 (7.33%)
Threonine (Thr, T)
n = 318 (8.36%)
Cysteine (Cys, C)
n = 23 (0.6%)
Valine (Val, V)
n = 186 (4.89%)
Leucine (Leu, L)
n = 607 (15.95%)
Isoleucine (Ile, I)
n = 335 (8.8%)
Methionine (Met, M)
n = 252 (6.62%)
Proline (Pro, P)
n = 192 (5.04%)
Phenylalanine (Phe, F)
n = 232 (6.1%)
Tyrosine (Tyr, Y)
n = 132 (3.47%)
Tryptophan (Trp, W)
n = 105 (2.76%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 98 (2.57%)
Asparagine (Asn, N)
n = 160 (4.2%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 99 (2.6%)
Lysine (Lys, K)
n = 99 (2.6%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
169 166 214 75 75 253 27 161 80 12 41 36 88 21 103 129
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 8 15 51 98 91 7 40 46 100 28 47 63 82 0 72
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
97 141 8 43 77 102 5 18 34 64 68 8 16 69 91 53
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
46 77 21 30 35 91 8 10 12 40 1 1 0 7 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
810 876 1217 904
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
458 984 753 1612
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
201 1088 1625 893

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.