Viewing data for Carcharhinus obscurus


Scientific name Carcharhinus obscurus
Common name Dusky shark
Maximum lifespan 35.00 years (Carcharhinus obscurus@AnAge)

Total mtDNA (size: 16706 bases) GC AT G C A T
Base content (bases) 6442 10264 4232 2210 5026 5238
Base content per 1 kb (bases) 386 614 253 132 301 314
Base content (%) 38.6% 61.4%
Total protein-coding genes (size: 11407 bases) GC AT G C A T
Base content (bases) 4416 6991 3091 1325 3522 3469
Base content per 1 kb (bases) 387 613 271 116 309 304
Base content (%) 38.7% 61.3%
D-loop (size: 1066 bases) GC AT G C A T
Base content (bases) 359 707 213 146 376 331
Base content per 1 kb (bases) 337 663 200 137 353 311
Base content (%) 33.7% 66.3%
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 617 934 343 274 433 501
Base content per 1 kb (bases) 398 602 221 177 279 323
Base content (%) 39.8% 60.2%
Total rRNA-coding genes (size: 2626 bases) GC AT G C A T
Base content (bases) 1026 1600 570 456 678 922
Base content per 1 kb (bases) 391 609 217 174 258 351
Base content (%) 39.1% 60.9%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 404 552 225 179 231 321
Base content per 1 kb (bases) 423 577 235 187 242 336
Base content (%) 42.3% 57.7%
16S rRNA gene (size: 1670 bases) GC AT G C A T
Base content (bases) 622 1048 345 277 447 601
Base content per 1 kb (bases) 372 628 207 166 268 360
Base content (%) 37.2% 62.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 250 434 183 67 217 217
Base content per 1 kb (bases) 365 635 268 98 317 317
Base content (%) 36.5% 63.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 45 123 36 9 57 66
Base content per 1 kb (bases) 268 732 214 54 339 393
Base content (%) 26.8% 73.2%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 580 977 338 242 551 426
Base content per 1 kb (bases) 373 627 217 155 354 274
Base content (%) 37.3% 62.7%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 259 432 159 100 211 221
Base content per 1 kb (bases) 375 625 230 145 305 320
Base content (%) 37.5% 62.5%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 322 464 202 120 241 223
Base content per 1 kb (bases) 410 590 257 153 307 284
Base content (%) 41.0% 59.0%
CYTB (size: 1145 bases) GC AT G C A T
Base content (bases) 457 688 319 138 368 320
Base content per 1 kb (bases) 399 601 279 121 321 279
Base content (%) 39.9% 60.1%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 394 581 289 105 283 298
Base content per 1 kb (bases) 404 596 296 108 290 306
Base content (%) 40.4% 59.6%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 396 649 300 96 319 330
Base content per 1 kb (bases) 379 621 287 92 305 316
Base content (%) 37.9% 62.1%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 143 206 93 50 116 90
Base content per 1 kb (bases) 410 590 266 143 332 258
Base content (%) 41.0% 59.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 540 841 397 143 419 422
Base content per 1 kb (bases) 391 609 287 104 303 306
Base content (%) 39.1% 60.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 128 169 93 35 95 74
Base content per 1 kb (bases) 431 569 313 118 320 249
Base content (%) 43.1% 56.9%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 709 1121 525 184 551 570
Base content per 1 kb (bases) 387 613 287 101 301 311
Base content (%) 38.7% 61.3%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 197 325 159 38 102 223
Base content per 1 kb (bases) 377 623 305 73 195 427
Base content (%) 37.7% 62.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 53 (23.35%)
Isoleucine (Ile, I)
n = 26 (11.45%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 10 9 11 6 16 1 19 9 0 1 2 6 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 5 5 8 0 1 3 5 0 1 3 11 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 2 0 1 0 1 3 4 0 0 0 3 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 0 1 1 0 0 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 67 75 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 61 33 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 55 109 61
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFLILLFSWIIFLTILPNKIMNHLFNNDPTLKSTEKPKPNPWNWPWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 8 (14.55%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 1 1 0 2 0 6 1 0 0 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 2 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 0 0 1 0 1 0 0 0 0 0 6 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 1 0 4 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 14 23 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 13 17 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 9 26 20
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.69%)
Alanine (Ala, A)
n = 44 (8.49%)
Serine (Ser, S)
n = 32 (6.18%)
Threonine (Thr, T)
n = 33 (6.37%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.53%)
Leucine (Leu, L)
n = 65 (12.55%)
Isoleucine (Ile, I)
n = 44 (8.49%)
Methionine (Met, M)
n = 24 (4.63%)
Proline (Pro, P)
n = 31 (5.98%)
Phenylalanine (Phe, F)
n = 39 (7.53%)
Tyrosine (Tyr, Y)
n = 18 (3.47%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 10 (1.93%)
Histidine (His, H)
n = 19 (3.67%)
Lysine (Lys, K)
n = 8 (1.54%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 11 20 25 8 11 1 20 9 1 15 5 18 1 27 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 14 10 19 1 19 5 17 4 12 2 16 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 0 10 4 14 0 2 2 16 2 0 0 10 5 12
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 0 11 4 8 0 2 0 7 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 114 128 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 96 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 88 202 216
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 13 (5.68%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 18 (7.86%)
Leucine (Leu, L)
n = 25 (10.92%)
Isoleucine (Ile, I)
n = 21 (9.17%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 6 10 5 3 9 0 7 9 0 7 4 7 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 7 4 6 0 4 2 2 0 6 1 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 0 2 2 9 0 2 1 5 5 0 1 4 0 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 15 1 5 7 4 0 2 1 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 55 58 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 56 65 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 48 98 79
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 21 (8.05%)
Serine (Ser, S)
n = 13 (4.98%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.51%)
Leucine (Leu, L)
n = 34 (13.03%)
Isoleucine (Ile, I)
n = 14 (5.36%)
Methionine (Met, M)
n = 8 (3.07%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 21 (8.05%)
Tyrosine (Tyr, Y)
n = 13 (4.98%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 7 13 5 4 0 12 8 0 7 2 7 1 8 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 5 7 9 0 4 6 11 0 4 1 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 0 3 6 1 1 2 8 5 0 0 1 2 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 0 2 3 2 0 2 0 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 64 53 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 58 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 71 112 76
CYTB (size: 1145 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 27 (7.11%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 17 (4.47%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 20 (5.26%)
Leucine (Leu, L)
n = 61 (16.05%)
Isoleucine (Ile, I)
n = 39 (10.26%)
Methionine (Met, M)
n = 13 (3.42%)
Proline (Pro, P)
n = 20 (5.26%)
Phenylalanine (Phe, F)
n = 34 (8.95%)
Tyrosine (Tyr, Y)
n = 14 (3.68%)
Tryptophan (Trp, W)
n = 13 (3.42%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 17 12 13 12 23 0 12 8 0 5 8 7 0 11 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 5 15 7 0 3 8 10 2 6 3 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 0 7 6 9 0 0 3 7 7 0 1 9 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 2 6 9 0 1 3 4 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 96 102 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
50 86 78 167
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 137 139 101
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 25 (7.72%)
Serine (Ser, S)
n = 22 (6.79%)
Threonine (Thr, T)
n = 23 (7.1%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.78%)
Leucine (Leu, L)
n = 66 (20.37%)
Isoleucine (Ile, I)
n = 31 (9.57%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 19 (5.86%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.09%)
Asparagine (Asn, N)
n = 12 (3.7%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 18 14 8 14 25 0 19 7 0 1 3 5 0 6 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 6 10 9 0 3 5 9 1 5 9 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 0 2 4 12 0 0 4 5 8 0 0 4 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 0 2 1 7 0 3 2 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 90 92 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 90 57 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 109 149 65
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 24 (6.92%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.15%)
Leucine (Leu, L)
n = 79 (22.77%)
Isoleucine (Ile, I)
n = 35 (10.09%)
Methionine (Met, M)
n = 11 (3.17%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 14 10 15 16 20 0 28 9 0 0 1 3 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 9 8 7 0 2 3 11 1 5 8 9 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 0 5 4 15 0 4 2 6 1 0 0 2 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 1 7 3 1 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 93 120 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 113 54 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 94 156 93
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 24 (6.92%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 43 (12.39%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 4 (1.15%)
Leucine (Leu, L)
n = 79 (22.77%)
Isoleucine (Ile, I)
n = 35 (10.09%)
Methionine (Met, M)
n = 11 (3.17%)
Proline (Pro, P)
n = 22 (6.34%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.32%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 14 10 15 16 20 0 28 9 0 0 1 3 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 9 8 7 0 2 3 11 1 5 8 9 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 0 5 4 15 0 4 2 6 1 0 0 2 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 0 0 1 7 3 1 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 93 120 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 113 54 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 94 156 93
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.36%)
Alanine (Ala, A)
n = 32 (6.97%)
Serine (Ser, S)
n = 37 (8.06%)
Threonine (Thr, T)
n = 38 (8.28%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 52 (11.33%)
Methionine (Met, M)
n = 22 (4.79%)
Proline (Pro, P)
n = 23 (5.01%)
Phenylalanine (Phe, F)
n = 23 (5.01%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 18 (3.92%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 14 (3.05%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 25 21 17 26 21 1 20 12 0 3 2 5 0 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 14 10 8 0 4 6 9 1 2 7 14 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 0 6 13 10 0 3 5 5 8 0 0 6 12 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 0 3 2 11 0 0 1 10 0 0 0 0 0 20
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 125 149 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 122 83 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 150 190 117
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 15 (15.31%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 5 6 3 6 6 0 4 2 0 0 1 0 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 6 2 3 0 2 2 1 0 2 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 4 5 3 0 2 1 1 0 0 0 1 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 1 0 1 1 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 23 28 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 32 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 38 32 28
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.43%)
Alanine (Ala, A)
n = 38 (6.24%)
Serine (Ser, S)
n = 54 (8.87%)
Threonine (Thr, T)
n = 50 (8.21%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 15 (2.46%)
Leucine (Leu, L)
n = 107 (17.57%)
Isoleucine (Ile, I)
n = 66 (10.84%)
Methionine (Met, M)
n = 23 (3.78%)
Proline (Pro, P)
n = 30 (4.93%)
Phenylalanine (Phe, F)
n = 41 (6.73%)
Tyrosine (Tyr, Y)
n = 13 (2.13%)
Tryptophan (Trp, W)
n = 14 (2.3%)
Aspartic acid (Asp, D)
n = 13 (2.13%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 35 (5.75%)
Glutamine (Gln, Q)
n = 17 (2.79%)
Histidine (His, H)
n = 16 (2.63%)
Lysine (Lys, K)
n = 25 (4.11%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 31 22 20 28 34 2 22 16 1 4 3 8 0 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 3 11 16 11 0 11 6 8 2 8 10 12 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 20 0 7 13 19 0 9 6 7 6 2 1 11 24 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 1 5 8 25 0 1 3 5 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 156 214 136
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 157 131 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 212 225 163
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (15.61%)
Alanine (Ala, A)
n = 13 (7.51%)
Serine (Ser, S)
n = 9 (5.2%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 1 (0.58%)
Valine (Val, V)
n = 22 (12.72%)
Leucine (Leu, L)
n = 31 (17.92%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 13 (7.51%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 10 (5.78%)
Tyrosine (Tyr, Y)
n = 11 (6.36%)
Tryptophan (Trp, W)
n = 8 (4.62%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 5 1 0 0 0 18 0 0 10 0 10 2 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 8 0 3 2 12 0 8 7 3 0 0 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 5 0 1 1 2 0 11 0 6 12 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 3 4 0 0 1 0 0 2 1 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 9 26 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 29 24 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
45 0 52 77
Total protein-coding genes (size: 11430 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 226 (5.94%)
Alanine (Ala, A)
n = 279 (7.33%)
Serine (Ser, S)
n = 270 (7.09%)
Threonine (Thr, T)
n = 285 (7.49%)
Cysteine (Cys, C)
n = 23 (0.6%)
Valine (Val, V)
n = 166 (4.36%)
Leucine (Leu, L)
n = 665 (17.47%)
Isoleucine (Ile, I)
n = 352 (9.25%)
Methionine (Met, M)
n = 163 (4.28%)
Proline (Pro, P)
n = 215 (5.65%)
Phenylalanine (Phe, F)
n = 239 (6.28%)
Tyrosine (Tyr, Y)
n = 119 (3.13%)
Tryptophan (Trp, W)
n = 123 (3.23%)
Aspartic acid (Asp, D)
n = 72 (1.89%)
Glutamic acid (Glu, E)
n = 98 (2.57%)
Asparagine (Asn, N)
n = 150 (3.94%)
Glutamine (Gln, Q)
n = 94 (2.47%)
Histidine (His, H)
n = 104 (2.73%)
Lysine (Lys, K)
n = 84 (2.21%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
198 154 137 136 131 175 6 201 92 2 53 32 77 4 115 124
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 12 11 92 89 94 4 66 47 94 19 58 48 105 4 75
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
86 123 1 53 56 101 3 27 30 76 43 8 16 60 90 49
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
55 93 5 37 35 80 4 13 15 44 1 0 1 7 0 115
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
841 934 1092 941
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
503 992 728 1585
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
104 1046 1538 1120

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.