Viewing data for Aphredoderus sayanus


Scientific name Aphredoderus sayanus
Common name Pirate perch
Maximum lifespan 4.00 years (Aphredoderus sayanus@AnAge)

Total mtDNA (size: 16601 bases) GC AT G C A T
Base content (bases) 7164 9437 4673 2491 4206 5231
Base content per 1 kb (bases) 432 568 281 150 253 315
Base content (%) 43.2% 56.8%
Total protein-coding genes (size: 11403 bases) GC AT G C A T
Base content (bases) 4910 6493 3381 1529 2985 3508
Base content per 1 kb (bases) 431 569 297 134 262 308
Base content (%) 43.1% 56.9%
D-loop (size: 991 bases) GC AT G C A T
Base content (bases) 364 627 215 149 307 320
Base content per 1 kb (bases) 367 633 217 150 310 323
Base content (%) 36.7% 63.3%
Total tRNA-coding genes (size: 1535 bases) GC AT G C A T
Base content (bases) 675 860 392 283 365 495
Base content per 1 kb (bases) 440 560 255 184 238 322
Base content (%) 44.0% 56.0%
Total rRNA-coding genes (size: 2616 bases) GC AT G C A T
Base content (bases) 1184 1432 666 518 538 894
Base content per 1 kb (bases) 453 547 255 198 206 342
Base content (%) 45.3% 54.7%
12S rRNA gene (size: 944 bases) GC AT G C A T
Base content (bases) 439 505 252 187 196 309
Base content per 1 kb (bases) 465 535 267 198 208 327
Base content (%) 46.5% 53.5%
16S rRNA gene (size: 1672 bases) GC AT G C A T
Base content (bases) 745 927 414 331 342 585
Base content per 1 kb (bases) 446 554 248 198 205 350
Base content (%) 44.6% 55.4%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 300 383 218 82 187 196
Base content per 1 kb (bases) 439 561 319 120 274 287
Base content (%) 43.9% 56.1%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 58 14 41 55
Base content per 1 kb (bases) 429 571 345 83 244 327
Base content (%) 42.9% 57.1%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 690 864 422 268 441 423
Base content per 1 kb (bases) 444 556 272 172 284 272
Base content (%) 44.4% 55.6%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 290 401 194 96 190 211
Base content per 1 kb (bases) 420 580 281 139 275 305
Base content (%) 42.0% 58.0%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 350 435 233 117 214 221
Base content per 1 kb (bases) 446 554 297 149 273 282
Base content (%) 44.6% 55.4%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 465 676 323 142 325 351
Base content per 1 kb (bases) 408 592 283 124 285 308
Base content (%) 40.8% 59.2%
ND1 (size: 973 bases) GC AT G C A T
Base content (bases) 427 546 290 137 252 294
Base content per 1 kb (bases) 439 561 298 141 259 302
Base content (%) 43.9% 56.1%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 437 605 331 106 243 362
Base content per 1 kb (bases) 419 581 318 102 233 347
Base content (%) 41.9% 58.1%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 150 199 103 47 101 98
Base content per 1 kb (bases) 430 570 295 135 289 281
Base content (%) 43.0% 57.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 590 791 401 189 367 424
Base content per 1 kb (bases) 427 573 290 137 266 307
Base content (%) 42.7% 57.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 136 161 99 37 79 82
Base content per 1 kb (bases) 458 542 333 125 266 276
Base content (%) 45.8% 54.2%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 789 1050 555 234 472 578
Base content per 1 kb (bases) 429 571 302 127 257 314
Base content (%) 42.9% 57.1%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 219 303 157 62 80 223
Base content per 1 kb (bases) 420 580 301 119 153 427
Base content (%) 42.0% 58.0%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 13 (5.75%)
Serine (Ser, S)
n = 10 (4.42%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (5.75%)
Leucine (Leu, L)
n = 54 (23.89%)
Isoleucine (Ile, I)
n = 21 (9.29%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 18 (7.96%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.21%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 7 10 11 11 20 4 8 7 2 1 4 4 4 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 4 6 0 3 3 3 1 1 12 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 2 1 1 1 0 5 2 1 0 0 0 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 0 1 2 0 0 3 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 83 71 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 58 33 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 77 91 45
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFMILVFSWCIFLSVLPPKVMAHSFPNDPNPQSTKTTKTTPWTWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 1 (1.82%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 2 1 2 1 0 0 2 0 0 3 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 0 2 0 0 0 0 0 0 3 3 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 0 0 0 3 0 0 1 1 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 1 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 18 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 21 12 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 20 25 10
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 49 (9.48%)
Serine (Ser, S)
n = 30 (5.8%)
Threonine (Thr, T)
n = 37 (7.16%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.74%)
Leucine (Leu, L)
n = 61 (11.8%)
Isoleucine (Ile, I)
n = 38 (7.35%)
Methionine (Met, M)
n = 26 (5.03%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 42 (8.12%)
Tyrosine (Tyr, Y)
n = 18 (3.48%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 14 22 12 8 21 5 12 8 0 10 4 21 5 22 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 4 22 21 2 4 19 20 4 7 8 12 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 0 6 9 10 1 1 3 7 11 1 3 2 12 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 1 5 9 8 0 1 3 5 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
161 110 128 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 140 92 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 172 203 115
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 12 (5.24%)
Serine (Ser, S)
n = 19 (8.3%)
Threonine (Thr, T)
n = 12 (5.24%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 15 (6.55%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 24 (10.48%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 6 (2.62%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 8 9 7 4 13 2 3 8 0 3 3 8 1 3 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 1 3 7 1 2 2 5 0 1 7 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 3 0 6 7 2 1 1 2 4 6 1 0 3 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 14 1 6 6 4 0 2 3 1 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 64 59 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 76 87 59
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 37 (14.23%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 6 7 8 14 2 6 7 0 1 3 9 1 9 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 10 8 0 3 8 8 0 0 5 7 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 3 3 6 0 0 4 5 5 1 0 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 1 3 2 4 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 72 56 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 67 54 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 94 110 50
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 63 (16.62%)
Isoleucine (Ile, I)
n = 34 (8.97%)
Methionine (Met, M)
n = 12 (3.17%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 22 (5.8%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 15 8 4 11 29 1 18 6 0 4 2 9 2 10 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 2 11 11 1 1 9 12 2 5 7 11 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 0 6 6 9 0 0 1 5 9 1 0 8 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 3 6 10 0 0 1 6 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 94 107 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 97 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 132 165 71
ND1 (size: 973 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.57%)
Alanine (Ala, A)
n = 32 (9.91%)
Serine (Ser, S)
n = 22 (6.81%)
Threonine (Thr, T)
n = 24 (7.43%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.02%)
Leucine (Leu, L)
n = 61 (18.89%)
Isoleucine (Ile, I)
n = 30 (9.29%)
Methionine (Met, M)
n = 11 (3.41%)
Proline (Pro, P)
n = 23 (7.12%)
Phenylalanine (Phe, F)
n = 17 (5.26%)
Tyrosine (Tyr, Y)
n = 12 (3.72%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.41%)
Asparagine (Asn, N)
n = 10 (3.1%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 6 (1.86%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 13 8 3 4 39 3 9 6 0 3 1 6 3 9 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 17 11 1 0 10 6 2 0 6 16 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 11 0 4 3 10 1 1 3 4 8 1 3 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 10 1 0 4 7 0 0 1 6 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 92 86 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 97 56 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 101 152 51
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.91%)
Alanine (Ala, A)
n = 29 (8.38%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 44 (12.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 21 (6.07%)
Methionine (Met, M)
n = 32 (9.25%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 16 (4.62%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 15 29 9 13 28 2 13 16 0 0 1 3 1 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 18 9 0 0 6 9 2 2 6 14 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 17 0 3 8 8 1 0 5 1 7 0 0 9 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 0 0 1 8 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 100 125 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 115 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 116 177 45
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.91%)
Alanine (Ala, A)
n = 29 (8.38%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 44 (12.72%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 21 (6.07%)
Methionine (Met, M)
n = 32 (9.25%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.18%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.02%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 16 (4.62%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 15 29 9 13 28 2 13 16 0 0 1 3 1 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 18 9 0 0 6 9 2 2 6 14 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 17 0 3 8 8 1 0 5 1 7 0 0 9 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 0 0 1 8 0 0 0 5 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 100 125 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 115 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 116 177 45
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 37 (8.06%)
Serine (Ser, S)
n = 27 (5.88%)
Threonine (Thr, T)
n = 43 (9.37%)
Cysteine (Cys, C)
n = 7 (1.53%)
Valine (Val, V)
n = 14 (3.05%)
Leucine (Leu, L)
n = 96 (20.92%)
Isoleucine (Ile, I)
n = 33 (7.19%)
Methionine (Met, M)
n = 30 (6.54%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 16 (3.49%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 14 (3.05%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 11 23 10 12 47 4 22 11 0 1 6 6 1 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 5 2 19 16 0 5 6 13 5 3 13 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 21 1 5 7 8 0 1 6 5 9 1 1 6 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 3 0 3 8 1 1 3 7 0 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
94 133 136 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 128 72 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 140 216 79
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 25 (25.51%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 2 (2.04%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 3 5 3 13 1 3 3 0 1 0 0 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 4 6 0 0 1 4 0 0 2 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 0 4 5 0 1 1 0 1 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 2 0 0 0 1 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 34 20 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 32 15 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 33 47 17
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.07%)
Alanine (Ala, A)
n = 53 (8.66%)
Serine (Ser, S)
n = 41 (6.7%)
Threonine (Thr, T)
n = 70 (11.44%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 21 (3.43%)
Leucine (Leu, L)
n = 94 (15.36%)
Isoleucine (Ile, I)
n = 55 (8.99%)
Methionine (Met, M)
n = 29 (4.74%)
Proline (Pro, P)
n = 30 (4.9%)
Phenylalanine (Phe, F)
n = 36 (5.88%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 10 (1.63%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 35 (5.72%)
Glutamine (Gln, Q)
n = 19 (3.1%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 21 (3.43%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 25 24 10 15 42 10 17 17 2 3 5 10 3 18 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 3 8 28 16 1 0 16 14 1 3 13 12 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
30 26 1 8 13 6 0 3 11 6 6 4 0 8 27 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 1 7 3 19 2 1 2 5 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
127 149 224 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 180 124 235
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 226 230 124
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.29%)
Alanine (Ala, A)
n = 15 (8.67%)
Serine (Ser, S)
n = 16 (9.25%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 22 (12.72%)
Leucine (Leu, L)
n = 24 (13.87%)
Isoleucine (Ile, I)
n = 9 (5.2%)
Methionine (Met, M)
n = 10 (5.78%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 11 (6.36%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 4 (2.31%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 1 3 3 0 0 1 11 0 1 10 0 7 5 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 0 6 0 2 7 5 4 0 14 2 0 0 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 9 2 3 1 1 0 8 3 3 9 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 4 0 1 0 1 0 1 1 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 12 27 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 37 22 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 13 31 76
Total protein-coding genes (size: 11425 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 237 (6.23%)
Alanine (Ala, A)
n = 308 (8.1%)
Serine (Ser, S)
n = 250 (6.57%)
Threonine (Thr, T)
n = 330 (8.68%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 180 (4.73%)
Leucine (Leu, L)
n = 640 (16.82%)
Isoleucine (Ile, I)
n = 296 (7.78%)
Methionine (Met, M)
n = 189 (4.97%)
Proline (Pro, P)
n = 223 (5.86%)
Phenylalanine (Phe, F)
n = 224 (5.89%)
Tyrosine (Tyr, Y)
n = 117 (3.08%)
Tryptophan (Trp, W)
n = 117 (3.08%)
Aspartic acid (Asp, D)
n = 69 (1.81%)
Glutamic acid (Glu, E)
n = 99 (2.6%)
Asparagine (Asn, N)
n = 136 (3.58%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 80 (2.1%)
Arginine (Arg, R)
n = 75 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
172 124 149 86 98 274 35 129 93 5 37 32 85 26 109 115
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 13 17 37 140 118 13 23 84 98 32 27 86 101 9 49
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
134 145 2 53 65 74 6 9 43 49 68 14 18 45 91 18
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
84 88 11 29 40 77 3 6 18 47 4 0 2 3 0 103
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
893 991 1085 836
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
513 1059 704 1529
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
220 1239 1584 762

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.